Recombinant Human Glutamyl Aminopeptidase (ENPEP) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-08278P

Greater than 90% as determined by SDS-PAGE.
Recombinant Human Glutamyl Aminopeptidase (ENPEP) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-08278P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Human Glutamyl Aminopeptidase (ENPEP) Protein (His) is produced by our E.coli expression system. This is a extracellular protein. |
Purity | Greater than 90% as determined by SDS-PAGE. |
Uniprotkb | Q07075 |
Target Symbol | ENPEP |
Synonyms | Aminopeptidase A; AMPE_HUMAN; AP-A; APA; bp-1; bp1; CD249; Differentiation antigen gp160; EAP; Enpep; Glutamyl aminopeptidase (aminopeptidase A); Glutamyl aminopeptidase; Gp160; Ly51 |
Species | Homo sapiens (Human) |
Expression System | E.coli |
Tag | N-6His |
Target Protein Sequence | YFQGQVKPIADSLGWNDAGDHVTKLLRSSVLGFACKMGDREALNNASSLFEQWLNGTVSLPVNLRLLVYRYGMQNSGNEISWNYTLEQYQKTSLAQEKEKLLYGLASVKNVTLLSRYLDLLKDTNLIKTQDVFTVIRYISYNSYGKNMAWNWIQLNWDYLVNRYTLNNRNLGRIVTIAEPFNTELQLWQMESFFAKYPQAGAGEKPREQVLETVKNNIEWLKQHRNTIREW |
Expression Range | 719-949aa |
Protein Length | Extracellular Domain |
Mol. Weight | 31.0kDa |
Research Area | Immunology |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | Regulates central hypertension through its calcium-modulated preference to cleave N-terminal acidic residues from peptides such as angiotensin II. |
Subcellular Location | Cell membrane; Single-pass type II membrane protein. |
Protein Families | Peptidase M1 family |
Database References | HGNC: 3355 OMIM: 138297 KEGG: hsa:2028 STRING: 9606.ENSP00000265162 UniGene: PMID: 28177885 |