Recombinant Human Glutaminase Kidney Isoform, Mitochondrial (GLS) Protein (GST)
Beta LifeScience
SKU/CAT #: BLC-09494P

Greater than 90% as determined by SDS-PAGE.
Recombinant Human Glutaminase Kidney Isoform, Mitochondrial (GLS) Protein (GST)
Beta LifeScience
SKU/CAT #: BLC-09494P
Collections: High-quality recombinant proteins, Other recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Human Glutaminase Kidney Isoform, Mitochondrial (GLS) Protein (GST) is produced by our E.coli expression system. This is a protein fragment. |
Purity | Greater than 90% as determined by SDS-PAGE. |
Uniprotkb | O94925 |
Target Symbol | GLS |
Synonyms | AAD20; DKFZp686O15119; FLJ10358; GAC; GAM; GLS; GLS1; GLSK_HUMAN; Glutaminase C; Glutaminase kidney isoform; Glutaminase phosphate activated; K-glutaminase; KGA; KIAA0838; L glutamine amidohydrolase; L-glutamine amidohydrolase; mitochondrial |
Species | Homo sapiens (Human) |
Expression System | E.coli |
Tag | N-GST |
Target Protein Sequence | KDRWNNTPMDEALHFGHHDVFKILQEYQVQYTPQGDSDNGKENQTVHKNLDGLL |
Expression Range | 616-669aa |
Protein Length | Partial |
Mol. Weight | 33.3kDa |
Research Area | Signal Transduction |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | Catalyzes the first reaction in the primary pathway for the renal catabolism of glutamine. Plays a role in maintaining acid-base homeostasis. Regulates the levels of the neurotransmitter glutamate, the main excitatory neurotransmitter in the brain.; Lacks catalytic activity. |
Subcellular Location | [Isoform 1]: Mitochondrion. Cytoplasm, cytosol.; [Isoform 3]: Mitochondrion.; [Glutaminase kidney isoform, mitochondrial 68 kDa chain]: Mitochondrion matrix.; [Glutaminase kidney isoform, mitochondrial 65 kDa chain]: Mitochondrion matrix. |
Protein Families | Glutaminase family |
Database References | HGNC: 4331 OMIM: 138280 KEGG: hsa:2744 STRING: 9606.ENSP00000317379 UniGene: PMID: 30458442 |