Recombinant Human Glutamate Receptor Ionotropic, Nmda 2A (GRIN2A) Protein (His)

Name: Recombinant Human Glutamate Receptor Ionotropic, Nmda 2A (GRIN2A) Protein (His)
Brand: Beta LifeScience
SKU: BLC-11098P
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Collections: High-quality recombinant proteins, Other recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human Glutamate Receptor Ionotropic, Nmda 2A (GRIN2A) Protein (His) is produced by our E.coli expression system. This is a protein fragment.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	Q12879
Target Symbol	GRIN2A
Synonyms	EPND; FESD; GluN2A; Glutamate [NMDA] receptor subunit epsilon-1; Glutamate receptor; Glutamate receptor ionotropic N methyl D aspartate 2A; GRIN 2A; GRIN2A; hNR2A; LKS; N methyl D aspartate receptor channel; subunit epsilon 1; N Methyl D Aspartate Receptor Subtype 2A; N methyl D aspartate receptor subunit 2A; N-methyl D-aspartate receptor subtype 2A; NMDA receptor subtype 2A; NMDAR 2A; NMDAR2A; NMDE1_HUMAN; NR2A; OTTHUMP00000160135; OTTHUMP00000174531
Species	Homo sapiens (Human)
Expression System	E.coli
Tag	N-6His
Target Protein Sequence	VYQRAVMAVGSLTINEERSEVVDFSVPFVETGISVMVSRSNGTVSPSAFLIGKAIWLLWGLVFNNSVPVQNPKGTTSKIMMHQYMTKFNQKGVEDALVSLKTGKLDAFIYDAAVLNYKAGRDEGCKLVTI
Expression Range	501-550aa & 601-630aa & 701-750aa
Protein Length	Partial
Mol. Weight	18.2kDa
Research Area	Transport
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Component of NMDA receptor complexes that function as heterotetrameric, ligand-gated ion channels with high calcium permeability and voltage-dependent sensitivity to magnesium. Channel activation requires binding of the neurotransmitter glutamate to the epsilon subunit, glycine binding to the zeta subunit, plus membrane depolarization to eliminate channel inhibition by Mg(2+). Sensitivity to glutamate and channel kinetics depend on the subunit composition; channels containing GRIN1 and GRIN2A have lower sensitivity to glutamate and faster deactivation kinetics than channels formed by GRIN1 and GRIN2B. Contributes to the slow phase of excitatory postsynaptic current, long-term synaptic potentiation, and learning.
Subcellular Location	Cell projection, dendritic spine. Cell membrane; Multi-pass membrane protein. Cell junction, synapse. Cell junction, synapse, postsynaptic cell membrane; Multi-pass membrane protein. Cytoplasmic vesicle membrane.
Protein Families	Glutamate-gated ion channel (TC 1.A.10.1) family, NR2A/GRIN2A subfamily
Database References	HGNC: 4585 OMIM: 138253 KEGG: hsa:2903 STRING: 9606.ENSP00000332549 UniGene: PMID: 29358611 GRIN2A mutation is associated with epilepsy-aphasia spectrum disorders but with a relatively low rate. PMID: 29896722 Lifetime mood disorder emerged as a more significant factor for suicidal ideation in systemic lupus erythematosus compared with NR2A gene polymorphism main and interaction effects. PMID: 29161964 The results of this study GRIN2A mutation is a genetic cause in less than 11% patients with Landau-Kleffner syndrome or atypical benign partial epilepsy. PMID: 29056244 Mutations P79R, C231Y, G483R and M705V caused a significant reduction in glutamate and glycine agonist potency, whilst D731N was non-responsive. These mutants, along with E714K, also showed significantly decreased total protein levels and trafficking to the cell surface, whilst C436R was not trafficked at all. PMID: 28242877 This review showed that GRIN2A associate with Obsessive-compulsive disorder. PMID: 28608743 This study demonstrates that GRIN2A mutations in melanoma cause heterogenous effects but some may be oncogenic. PMID: 27659111 data indicate that children with epilepsy due to pathogenic GRIN2A mutations present with different clinical phenotypes and a spectrum of seizure types in the context of a pharmacoresistant epilepsy. PMID: 28109652 a de novo missense mutation in the GRIN2A gene in a patient with childhood focal epilepsy and acquired epileptic aphasia. The mutant decreases NMDAR activation suggesting NMDAR hypofunction may contribute to the epilepsy pathogenesis. PMID: 28182669 genetic association studies in population in China: Data suggest that one SNP in GRIN2A (rs2650429; but not rs6497540 or rs9302415) is associated with lead-induced neurotoxicity; in this case-control study, cases were lead-exposed workers from battery plants. Lead-exposed individuals have lower serum GRIN2A levels compared with controls; lead decreases GRIN2A expression levels in HEK293 cell. PMID: 27230353 Two adjacent phenylalanines in the NMDA receptor GluN2A subunit M3 domain interactively regulate alcohol sensitivity and ion channel gating. PMID: 27876530 The GRIN2A genotype was not associated with the rate of clinical progression of PD in the placebo group. PMID: 28320167 most rare variants in GluN2A were associated with epilepsy, whereas GluN2B variants were associated with intellectual disability with or without seizures PMID: 27839871 the gain-of-function M817V mutation causes overactivation of NMDAR and drives neuronal hyperexcitability. PMID: 28126851 To determine genetic variability within the N-methyl-D-aspartate receptor 2A sub-unit (GRIN2A) gene promoter and its association with concussion recovery time. PMID: 26502998 Findings suggest that mutations in GRIN2A preferentially are involved in genetic variance of pediatric idiopathic generalized epilepsy and do not contribute significantly to either adult focal epilepsies as temporal lobe epilepsy or generalized epilepsies PMID: 26220384 Based on large, well-characterized datasets independent from the original study, our results are not in favor of an interaction between caffeinated coffee consumption and GRIN2A rs4998386 for Parkinson disease risk PMID: 25412286 NMDARs have a dual role during erythropoiesis, supporting survival of polychromatic erythroblasts and contributing to the Ca(2+) homeostasis from the orthochromatic erythroblast stage to circulating red blood cells. PMID: 25788577 GRIN2A (GT)21 may play a significant role in the etiology of schizophrenia among the Chinese Han population of Shaanxi. PMID: 25958346 GRIN2A gene polymorphisms confer susceptibility to heroin addiction. PMID: 25366762 Dysarthria and dyspraxia are found in individuals with GRIN2A mutations, often in the setting of epilepsy-aphasia syndromes. The speech phenotype may occur in the absence of a seizure disorder, reinforcing the role for GRIN2A in motor speech function. PMID: 25596506 The reported association of a single nucleotide polymorphism, GRIN2A_rs4998386, and its interaction with caffeine intake with PD in Sweden, was replicated. PMID: 24915238 We demonstrate the functional importance of GRIN2A mutations in melanoma and the significance that ionotropic glutamate receptor signaling has in malignant melanoma. PMID: 24739903 study describes two children with a GRIN2A mutation and epilepsy, with one having a microdeletion on chromosome 16p13 PMID: 24125812 Array comparative genomic hybridization (aCGH) is used to confirm genes for epileptic and other neurodevelopmental disorders, including GRIN2A and proline-rich transmembrane protein (PRRT), both found in rolandic epilepsy. PMID: 24372385 A possible role for GRIN2A polymorphisms in heroin addiction. PMID: 23940648 The sigma-1 receptor was coisolated with GluN1 receptor subunit but not with the GluN2A subunit. PMID: 24227730 GRIN2A mutations cause epilepsy-aphasia spectrum disorders. PMID: 23933818 Mutations in GRIN2A cause idiopathic focal epilepsy with rolandic spikes. PMID: 23933819 GluN2A(F636) plays an important role in both channel function and ethanol inhibition in NMDA receptors. PMID: 23847085 The results of this study indicated that rs2072450 of GRIN2A might confer risk for alcohol dependence through deficient fear acquisition indexed by a diminished amygdala response during aversive learning,. PMID: 23693003 GRIN2A single nucleotide polymorphisms are asociated with phenotypic brain volume variations in multiple slcerosis. PMID: 22851457 After 7 days of chronic alcohol exposure there are significant increases in mRNA expression of GRIN2A in cultured neurons derived from alcoholic subjects, but not in cultures from nonalcoholics. PMID: 22486492 Two de novo mutations in GRIN2A are identified in patients with sporadic schizophrenia. PMID: 22833210 The results show a significant association between polymorphism of the GRIN2A gene and alcoholism. PMID: 21507155 NMDA subunit NR2A is not involved in amygdala hyperexcitability of patients with temporal lobe epilepsy. PMID: 20848605 glutamate receptor gene GRIN2A is a Parkinson's disease modifier gene via interaction with coffee PMID: 21876681 Polymorphism rs11866328 in the GRIN2A gene might be a genetic variant underlying the susceptibility of HBV carriers to disease progression. PMID: 22004137 identified as prime candidate gene for photoparoxysmal response PMID: 21883175 This review focuses on the role of the NMDA receptor subunits in schizophrenia, particularly via altering the balance of NR2 subunits during early development, could influence NRG1 signalling {REVIEW} PMID: 21371516 Exome sequencing identifies GRIN2A as frequently mutated in melanoma. PMID: 21499247 Data show that that all seven currently known NMDAR subunits (NR1, NR2A, NR2B, NR2C, NR2D, NR3A and NR3B) are expressed in astrocytes, but at different levels. PMID: 21152063 In melanoma, GRIN2A is identified as a common somatic mutation. PMID: 21499247 Mutations cause mental neurodevvelopmental disordes such as epilepsy and mental retardation. PMID: 20890276 Data demonstrate that tat treatment of human neurons results in tyrosine phosphorylation of the NMDAR subunit 2A (NR2A) in a src kinase-dependent manner. PMID: 20448061 Functional (GT)n polymorphisms in promoter region of N-methyl-d-aspartate receptor 2A subunit (GRIN2A) gene affect hippocampal and amygdala volumes PMID: 20070378 the PFC, glutamatergic regulation of PV-containing inhibitory neurons via NR2A-containing NMDA receptors does not appear to be altered in bipolar disorder. PMID: 20148871 Tyrosine-1325 phosphorylation regulates N-methyl-D-aspartate (NMDA) receptor channel properties and NMDA receptor-mediated downstream signaling to modulate depression-related behavior. PMID: 19834457 The C-terminus of NR2A is critical for modulation of desensitization by calcineurin. PMID: 11985816 The levels of NR2A mRNA are decreased in Alzheimer disease hippocampus and entorhinal cortex compared to controls. PMID: 12127670

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.