Recombinant Human Glutamate Receptor Ionotropic, Nmda 1 (GRIN1) Protein (His)

Name: Recombinant Human Glutamate Receptor Ionotropic, Nmda 1 (GRIN1) Protein (His)
Brand: Beta LifeScience
SKU: BLC-00053P
Availability: InStock

Greater than 85% as determined by SDS-PAGE.

Collections: High-quality recombinant proteins, Other recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human Glutamate Receptor Ionotropic, Nmda 1 (GRIN1) Protein (His) is produced by our E.coli expression system. This is a protein fragment.
Purity	Greater than 85% as determined by SDS-PAGE.
Uniprotkb	Q05586
Target Symbol	GRIN1
Synonyms	GluN1; Glutamate [NMDA] receptor subunit zeta-1; Glutamate receptor ionotropic N methyl D aspartate 1; Glutamate receptor ionotropic, N-methyl-D aspartate, subunit 1; glutamate receptor ionotropic, NMDA 1; Grin1; MRD8; N methyl D aspartate receptor; N methyl D aspartate receptor channel subunit zeta 1; N methyl D aspartate receptor subunit NR1; N-methyl-D-aspartate receptor subunit NR1; NMD-R1; NMDA 1; NMDA R1; NMDA receptor 1; NMDA1; NMDAR; NMDZ1_HUMAN; NR1
Species	Homo sapiens (Human)
Expression System	E.coli
Tag	N-6His
Target Protein Sequence	EIAYKRHKDARRKQMQLAFAAVNVWRKNLQDRKSGRAEPDPKKKATFRAITSTLASSFKRRRSSKDTSTGGGRGALQNQKDTVLPRRAIEREEGQLQLCSRHRES
Expression Range	834-938aa
Protein Length	Partial
Mol. Weight	18.0 kDa
Research Area	Neuroscience
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Component of NMDA receptor complexes that function as heterotetrameric, ligand-gated ion channels with high calcium permeability and voltage-dependent sensitivity to magnesium. Channel activation requires binding of the neurotransmitter glutamate to the epsilon subunit, glycine binding to the zeta subunit, plus membrane depolarization to eliminate channel inhibition by Mg(2+). Sensitivity to glutamate and channel kinetics depend on the subunit composition.
Subcellular Location	Cell membrane; Multi-pass membrane protein. Cell junction, synapse, postsynaptic cell membrane. Cell junction, synapse, postsynaptic density.
Protein Families	Glutamate-gated ion channel (TC 1.A.10.1) family, NR1/GRIN1 subfamily
Database References	HGNC: 4584 OMIM: 138249 KEGG: hsa:2902 STRING: 9606.ENSP00000360608 UniGene: PMID: 28378791 In this study, we report a success of the WES approach to the identification of a genetic cause of a challenging case, undiagnosed on clinical grounds. We identified the causative missense mutation (p.Met727Val) in exon 16 of the GRIN1 gene. As the p.Met727Val mutation shown by WES is in the same GluN1 domain, we infer that the pathogenic variant impact on NMDAR is likely similar to that induced by p.Glu662Lys mutation. PMID: 29194067 one base difference in the GRIN1M promoter sequence (G --> C) results in the inability of the sequence to form a parallel G-quadruplex. PMID: 28702665 Data suggest GRINL1A (GCOM1)-NMDA receptor-internexin-alpha (INA) interaction pathway may be relevant to neuroprotection. PMID: 29339073 These results indicate these individuals may have suffered neurodevelopmental deficits as a result of the decreased presence of GluN1-G620R/GluN2B complexes on the neuronal surface during embryonic brain development and reduced current responses of GluN1-G620R-containing NMDARs after birth. PMID: 28228639 Mice with GRIN1 disrupted in the intralaminar thalamic nuclei exhibited various schizophrenia-like phenotypes, including deficits in working memory, long-term spatial memory, and attention, as well as impulsivity, impaired prepulse inhibition, hyperlocomotion and hyperarousal. PMID: 28244984 2-methoxyestradiol impacts on glycine/serine-mediated metabolic reprogramming in osteosarcoma cells by its interaction with GRIN1/GluN2A receptors. PMID: 28262924 tPA is a ligand of the N-terminal domain of the obligatory GluN1 subunit of NMDAR acting as a modulator of their dynamic distribution at the neuronal surface and subsequent signaling. PMID: 27831563 Two novel Grin1 mutations were identified in 2 cases of severe early infantile encephalopathy. Se688Tyr mutation results in disruption of NMDA ligand binding and the p.Gly827Arg mutation results in disrupted gating of the ion channel. PMID: 28389307 A homozygous missense variant of GRIN1 was identified in two consanguineous sibs affected with severe intellectual disability and autistic features. PMID: 28051072 NMDA receptor-dependent signaling is involved in melanosome transfer, which is associated with calcium influx, cytoskeleton protein redistribution, dendrites and filopodia formation PMID: 27596138 Findings show that N-methyl-d-aspartic acid receptor subunit GluN1 is expressed on oligodendrocytes and myelin in humans. PMID: 27443784 De novo GRIN1 mutations are associated with severe intellectual disability with cortical visual impairment as well as oculomotor and movement disorders being discriminating phenotypic features. Loss of NMDA receptor function appears to be the underlying disease mechanism. The identification of both heterozygous and homozygous mutations blurs the borders of dominant and recessive inheritance of GRIN1-associated disorders. PMID: 27164704 The differences in cortical NMDAR expression and post-synaptic density protein 95 are present in psychiatric disorders and suicide completion and may contribute to different responses to ketamine. PMID: 26013316 GRIN1 (rs4880213) was significantly associated with depression and disruptive behavior in adolescents. PMID: 26819771 Knockdown of PKD1 did not affect NMDAR internalization but prevented the phosphorylation and inhibition of remaining surface NMDARs and NMDAR-mediated synaptic functions. PMID: 26584860 Study found GluN receptor subunit-specific changes in mixed subcortical ischemic vascular dementia(SIVD)/Alzheimer's disease(AD) (decreased GluN1) and SIVD (increased GluN2A and 2B), likely reflecting interaction of ischemic neurovascular and AD processes PMID: 25261450 results suggest that NMDA-R autoantibodies are unlikely to account for a large proportion of treatment-refractory psychosis. PMID: 25431428 The results of this study suggested that GRIN1 mutations cause encephalopathy resulting in seizures and movement disorders. PMID: 25864721 Genome-wide significant marker, SNP rs524991, and an association of seropositivity with influenza autoantibodies status, we provide genetic and environmental risk factors of NMDAR-autoantibodies formation PMID: 23999527 Epigenetic changes in GRIN1, in combination with experiences of maltreatment, may confer risk for depression in children. PMID: 24655651 Reduction in NR1 and NR2C in the DLPFC of people with schizophrenia may lead to altered NMDAR stoichiometry and provides compelling evidence for an endogenous NMDAR deficit in schizophrenia. PMID: 23070074 Isolated GluN1/GluN3A receptors integrated into lipid bilayers responded to addition of either glycine or d-serine, but not glutamate, with a approximately 1 nm reduction in height of the extracellular domain PMID: 25017909 Results show that the expression and distribution of NMDA receptors subunits GluN1, GluN2A and GluN2B - together with that of postsynaptic protein PSD-95 - are modified in Alzheimer's disease compared to normal aging PMID: 24156266 B7T inhibition of NMDA current mediated by NR1/NR2B receptor. PMID: 23271275 The rs1126442, GRIN1 polymorphism contributes to the genetic vulnerability to psychosis in METH-dependent subjects in the Thai population. PMID: 23880023 Association of multiple sclerosis disease severity and allelic variants of the NR1 and NR2B glutamate receptor genes. PMID: 23840674 GluN1 binds specifically to the sigma-1 receptor within intact cells. PMID: 24227730 Antibodies that bind recombinant GluN1-S2 peptides (but not the intact GluN1 protein) develop transiently in patients after stroke in proportion to infarct size, suggesting that these antibodies are raised secondarily to neuronal damage. PMID: 23723305 Transgenic NR1 receptors on neuradrenergic neurons regulate development of opiate dependence and psychomotor sensitization. PMID: 22040728 After 7 days of chronic alcohol exposure, there are significant increases in mRNA expression of GRIN1 in cultured neurons derived from alcoholic subjects, but not in cultures from nonalcoholics. PMID: 22486492 Adult NR1-deficient transgenic mice show multiple abnormal behaviors including reduced social interactions, locomotor hyperactivity, self-injury, deficits in prepulse inhibition and sensory hypersensitivity, among others. PMID: 22726567 GRIN1 and GRIN2D appear instrumental to normal brain development and function in this study of rare and/or de novo mutation in neurodevelopmental disorders. PMID: 22833210 The multifunctional cytokine-like molecule HMGB1 released by activated, stressed, and damaged or necrotic cells can facilitate NMDAR-mediated cell responses. PMID: 22952988 A critical role of the single glutamine residue within the GluN1 M4 domain regulates surface delivery of functional NMDA receptors. PMID: 22937865 key amino acid residues within both NR1 and NR2B M3 domains contribute to the regulation of the surface expression of unassembled NR1 and NR2 subunits PMID: 22711533 The unique co-existence of SP and phospho-NMDAR1 in tendinopathy presumably reflects a tissue proliferative and nociceptive role. PMID: 22354721 GluN1(hypo) transgenic mice exhibit impairments on all tests of cognition that are employed, as well as reduced engagement in naturalistic behaviors, including nesting and burrowing. PMID: 22300668 The NR1 subunit of NMDA receptors is involved in amygdala hyperexcitability in some patients who have temporal lobe epilepsy. PMID: 20848605 G Protein-regulated inducer of neurite outgrowth (GRIN) modulates Sprouty protein repression of mitogen-activated protein kinase (MAPK) activation by growth factor stimulation PMID: 22383529 Transgenic mice with dopaminergic neuron-specific NMDAR1 deletion are impaired in a variety of habit-learning tasks, while normal in some other dopamine-modulated functions such as locomotor activities. PMID: 22196339 Homozygotes for the T allele in the rs4880213 GRIN1 SNP had reduced intracortical inhibition, as expected for enhanced glutamatergic excitation in these subjects. PMID: 21753020 NMDAR1 subunit expressed by primary afferent nerves of floxed mice plays an important role in the development of sensitized pain states. PMID: 20974228 Expression of NMDA receptors in lymphocytes is regulated by central nervous system, which controls the inflammation process. PMID: 20414717 The results of this study suggested that haplotypes of GRIN1 may influence responsiveness to ACTH. PMID: 20722663 Sp4 hypomorphic mice could therefore serve as a genetic model to investigate impaired NMDA functions resulting from loss-of-function mutations of human SP4 gene in schizophrenia and/or other psychiatric disorders. PMID: 20634195 Both tissue-type PA (tPA) and urokinase-type PA (uPA) bind to NMDA-R1 and reverse this effect, thereby enhancing acetylcholine-induced tracheal contractility. PMID: 20097831 Functional NMDA receptors are expressed by breast cancer and are important agents for maintaining cell growth and viability. PMID: 19784770 Polymorphisms in the GRIN1 and GRIN2B genes may serve as potential biomarkers for a reduced risk of PD among the Chinese population in Taiwan. PMID: 20438806 The neuronal coexistence of glutamate and NMDAR1, observed in painful tendinosis but not in controls, suggests a regulatory role in intensified pain signalling. PMID: 19422642

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.