Recombinant Human Glioma Pathogenesis-Related Protein 1 (GLIPR1) Protein (His)

Name: Recombinant Human Glioma Pathogenesis-Related Protein 1 (GLIPR1) Protein (His)
Brand: Beta LifeScience
SKU: BLC-10292P
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Collections: High-quality recombinant proteins, Other recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human Glioma Pathogenesis-Related Protein 1 (GLIPR1) Protein (His) is produced by our E.coli expression system. This is a protein fragment.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	P48060
Target Symbol	GLIPR1
Synonyms	CRISP 7; CRISP7; GLI pathogenesis related 1; GLI pathogenesis-related 1 (glioma); Glioma pathogenesis related protein 1; Glioma pathogenesis-related protein 1; GLIP1_HUMAN; GliPR 1; GLIPR; GLIPR1; Protein RTVP-1; RELATED TO TESTIS SPECIFIC; VESPID; AND PATHOGENESIS PROTEINS 1; RTVP 1; RTVP1; Testes specific vespid and pathogenesis protein 1; testes-specific vespid and pathogenesis protein 1
Species	Homo sapiens (Human)
Expression System	E.coli
Tag	N-6His
Target Protein Sequence	ANILPDIENEDFIKDCVRIHNKFRSEVKPTASDMLYMTWDPALAQIAKAWASNCQFSHNTRLKPPHKLHPNFTSLGENIWTGSVPIFSVSSAITNWYDEIQDYDFKTRICKKVCGHYTQVVWADSYKVGCAVQFCPKVSGFDALSNGAHFICNYGPGGNYPTWPYKRGATCSACPNNDKCLDNLCVNRQRDQVKRYYSVVYPGWPIYPRNR
Expression Range	22-232aa
Protein Length	Partial
Mol. Weight	28.1kDa
Research Area	Cancer
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Subcellular Location	Membrane; Single-pass membrane protein.
Protein Families	CRISP family
Database References	HGNC: 17001 OMIM: 602692 KEGG: hsa:11010 STRING: 9606.ENSP00000266659 UniGene: PMID: 28799673 High GLIPR1 expression is associated with cisplatin resistance in lung cancer. PMID: 28771580 The present study identified GLIPR1 and miR-16 as key components for regulating the proliferation, migration, invasion and cancer-initiating cells in osteosarcoma PMID: 27460987 This study reveals a novel pathway that PRMT5/WDR77 regulates GLIPR1 expression to control lung cancer cell growth. PMID: 26988096 Overexpression of RTVP-1 in human neural stem cells induced mesenchymal differentiation, whereas silencing of RTVP-1 in glioma stem cells (GSCs) decreased the mesenchymal transformation and stemness of these cells. PMID: 26267319 RTVP-1 regulates glioma cell spreading, migration and invasion and that these effects are mediated via interaction with N-WASP and by interfering with the inhibitory effect of hnRNPK on the function of this protein. PMID: 26305187 Data indicate that combining adenoviral vector-mediated GLIPR1 gene therap (AdGLIPR1) with radiotherapy may achieve additive or synergistic tumor control in selected prostate and bladder tumors. PMID: 23433894 Based on the observed overexpression in AML samples, GliPR1 should be further explored as a potential target for AML PMID: 24008279 miR-137 inhibits Glioblastom stem cell self-renewal and promotes their differentiation by targeting RTVP-1 which down-regulates CXCR4. PMID: 23714687 GLIPR1 interacts with Hsc70, and GLIPR1 overexpression or Hsc70 knockdown leads to transcriptional suppression of AURKA and TPX2. PMID: 23333597 GLIPR1 core structure has a conserved central cavity via which CAP proteins are likely to bind to shared ligands. PMID: 21931216 Data show that the expression of GLIPR1 and c-Myc were inversely correlated in prostate cancer. PMID: 22025562 RTVP-1 plays a role in the effect of serum response factor on glioma cell migration PMID: 21777672 demonstrate that GLIPR1 is a methylation-silenced gene in the acute myeloid leukemia patients PMID: 21922325 GLIPR1 expression is downregulated or even lost by promoter methylation in acute myeloid leukemia. PMID: 19483285 X-ray data have been collected to beyond 1.9 A resolution from a crystal of GLIPR1 that belonged to the orthorhombic space group P2(1)2(1)2 with average unit-cell parameters a = 85.1, b = 79.5, c = 38.9 A and either a monomer or dimer PMID: 21045302 Induction of GliPR expression by HIV-1 was confirmed in P4-CCR5 cells. PMID: 20356381 Expression of the human RTVP-1 gene is down-regulated in human prostate cancer specimens compared with normal human prostate tissue at the mRNA and protein levels. PMID: 14871827 In this study we report the identification and characterization of a novel p53 target gene cluster that includes human RTVP1 (hRTVP-1) together with two GLIPR1L genes (GLIPR1L1 and GLIPR1L2) on human chromosome 12q21 and mouse Rtvp1 PMID: 16714093 RTVP-1b is a novel splice variant of human RTVP-1, which was isolated from the U87 glioma cell line PMID: 17825796 a role for GLIPR1/RTVP-1 deregulation early in Wilms tumorigenesis. PMID: 18030365 GLIPR1 is a proapoptotic tumor suppressor acting through the ROS-JNK pathway. PMID: 18199537

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.