Recombinant Human Gastrokine-1 (GKN1) Protein (His)

Name: Recombinant Human Gastrokine-1 (GKN1) Protein (His)
Brand: Beta LifeScience
SKU: BLC-07224P
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Collections: High-quality recombinant proteins, Other recombinant proteins, Recombinant proteins fall special offers - full-length proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human Gastrokine-1 (GKN1) Protein (His) is produced by our E.coli expression system. This is a full length protein.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	Q9NS71
Target Symbol	GKN1
Species	Homo sapiens (Human)
Expression System	E.coli
Tag	N-6His
Target Protein Sequence	NYNINVNDDNNNAGSGQQSVSVNNEHNVANVDNNNGWDSWNSIWDYGNGFAATRLFQKKTCIVHKMNKEVMPSIQSLDALVKEKKLQGKGPGGPPPKGLMYSVNPNKVDDLSKFGKNIANMCRGIPTYMAEEMQEASLFFYSGTCYTTSVLWIVDISFCGDTVEN
Expression Range	35-199aa
Protein Length	Full Length of Mature Protein
Mol. Weight	24.2 kDa
Research Area	Others
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Has mitogenic activity and may be involved in maintaining the integrity of the gastric mucosal epithelium.
Subcellular Location	Secreted. Cytoplasmic granule. Golgi apparatus.
Protein Families	Gastrokine family
Database References	HGNC: 23217 OMIM: 606402 KEGG: hsa:56287 STRING: 9606.ENSP00000367172 UniGene: PMID: 27590582 These results did not confirm GKN1 as a potential biomarker for gastric cancer. PMID: 27452910 Low GKN1 expression is associated with gastric cancer. PMID: 27250838 GKN1 may contribute to the maintenance of gastric epithelial homeostasis and inhibit gastric carcinogenesis by down-regulating the gastrin-cholecystokinin B receptor signaling pathway. PMID: 25752269 Gastrokine 1 indirectly participates in actin stabilization since its overexpression in gastric cancer cells strongly increases the expression of tight and adherens junction proteins PMID: 26008777 AMP-18 appears to act through PI3K/AKT pathways to increase p21 phosphorylation, thereby reducing its nuclear accumulation to overcome the antiproliferative effects of TNF-alpha. PMID: 25919700 Results suggest a potential association between CRP and GPC5 variants with lung cancer risk; variation in GKN1 is associated with chemotherapy response in the Chinese Han population. PMID: 25999661 GKN1 inhibits metastasis in gastric cancer cells. PMID: 25725220 GKN1 may shorten telomeres by acting as a potential c-myc inhibitor that eventually leads to senescence and apoptosis in gastric cancer cells PMID: 25344918 GKN1 expression in the gastric mucosa of gastric cancer patients is decreased; this is associated with progression and prognosis of gastric cancer. PMID: 25469040 Data show that recombinant gastrokine 1 (GKN1) interacts with amyloid-beta peptide (1-40) preventing its aggregation. PMID: 25139219 These results suggest that GKN1 might be a target to inhibit the effects from H.pylori CagA. PMID: 25239641 Low GKN1 activity is associated with gastric cancers. PMID: 23812904 Epstein-Barr virus EBNA1 binds to the divergent promoter of the GKN1 and GKN2 genes and contributes to the complex transcriptional and epigenetic deregulation of the GKN1 and GKN2 tumor suppressor genes. PMID: 24460791 Our results show that GKN1 has an miR-185-dependent and -independent mechanism for chromatic and DNA epigenetic modification, thereby regulating the cell cycle PMID: 23846337 Data suggest GKN1 is expressed in placental trophoblasts in third trimester (not first); GKN1 expression is limited to extravillous trophoblasts. GKN1 expression is downregulated in choriocarcinoma; GKN1 attenuates migration of choriocarcinoma cells. PMID: 23993393 These data demonstrate that in the presence of GKN2, GKN1 loses its ability to decrease cell proliferation, induce apoptosis, and inhibit epigenetic alterations in gastric cancer cells. PMID: 24151046 these results suggest that the NH2-terminal hydrophobic region and BRICHOS domain of GKN1 are sufficient for its tumor suppressor activities. PMID: 24099765 the GKN1 gene may inhibit progression of gastric epithelial cells to cancer cells by regulating NF-kappaB signaling pathway and cytokine expression. PMID: 23444260 Molecular and functional properties of human GKN1 indicate a more significant propensity for beta-sheet structures. PMID: 23319233 Low expression of gastrokine 1 is associated with gastric cancer. PMID: 23317277 Expression of GKN1 is progressively lost from normal mucosa, precancerous to cancerous gastric tissues, while restoration of GKN1 expression induces gastric cancer cells to undergo apoptosis. PMID: 22621392 There is no direct molecular interaction between GKN1 and TFF1 in protein level in gastric cancer. PMID: 22842654 Both Helicobacter pylori infection and long-term non-steroidal anti-inflammatory drug administration downregulate gastrokine-1 expression in the gastric mucosa, which may contribute to the gastric mucosal injuries induced by these two factors. PMID: 22798109 GKN1 inhibits gastric cancer cell proliferation. PMID: 21751384 The GKN1 gene may play an important role in the progression of sporadic gastric cancers via inhibition of EMT and cancer cell migration PMID: 21898090 GKN1 modulates apoptotic signals and might play an important role for tissue repair during the early stages of neoplastic transformation. PMID: 21792914 AMP-18 could protect the intestinal mucosal barrier by acting on specific tight junction proteins and stabilizing perijunctional actin PMID: 15961882 study demonstrated the presence of gastrokine-1 isoforms of which the basic isoform was reduced in a subset of patients with H. pylori infection. PMID: 17092786 GKN1 and GKN2 expression occurs frequently in gastric adenocarcinomas, especially in the diffuse subtype PMID: 18593995 GKN1 expression is related to the inflammatory damage of gastric mucosa and could be the related to the gastric cellular phenotype. PMID: 18927498

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.