Recombinant Human Gastrin-Releasing Peptide (GRP) Protein (GST)
Beta LifeScience
SKU/CAT #: BLC-10945P
Greater than 90% as determined by SDS-PAGE.
Recombinant Human Gastrin-Releasing Peptide (GRP) Protein (GST)
Beta LifeScience
SKU/CAT #: BLC-10945P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Human Gastrin-Releasing Peptide (GRP) Protein (GST) is produced by our Yeast expression system. This is a protein fragment. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Uniprotkb | P07492 |
| Target Symbol | GRP |
| Synonyms | BN; Bombesin; GRP; GRP-10; GRP_HUMAN; GRP10; Neuromedin-C; NeuromedinC; Pre progastrin releasing peptide; PreproGRP; ProGRP |
| Species | Homo sapiens (Human) |
| Expression System | Yeast |
| Tag | N-GST |
| Target Protein Sequence | STGESSSVSERGSLKQQLREYIRWEEAARNLLGLIEAKENRNHQPPQPKALGNQQPSWDSEDSSNFKD |
| Expression Range | 54-121aa |
| Protein Length | Partial |
| Mol. Weight | 35.1 kDa |
| Research Area | Signal Transduction |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Stimulates the release of gastrin and other gastrointestinal hormones. Contributes to the perception of prurient stimuli and to the transmission of itch signals in the spinal cord that promote scratching behavior. Contributes primarily to nonhistaminergic itch sensation. Contributes to long-term fear memory, but not normal spatial memory. Contributes to the regulation of food intake. |
| Subcellular Location | Secreted. Cytoplasmic vesicle, secretory vesicle lumen. |
| Protein Families | Bombesin/neuromedin-B/ranatensin family |
| Database References | HGNC: 4605 OMIM: 137260 KEGG: hsa:2922 STRING: 9606.ENSP00000256857 UniGene: PMID: 29729229 |
