Recombinant Human Gastric Inhibitory Polypeptide Receptor (GIPR) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-05018P

Greater than 85% as determined by SDS-PAGE.
Recombinant Human Gastric Inhibitory Polypeptide Receptor (GIPR) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-05018P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Human Gastric Inhibitory Polypeptide Receptor (GIPR) Protein (His) is produced by our E.coli expression system. This is a protein fragment. |
Purity | Greater than 85% as determined by SDS-PAGE. |
Uniprotkb | P48546 |
Target Symbol | GIPR |
Synonyms | GIPR; Gastric inhibitory polypeptide receptor; GIP-R; Glucose-dependent insulinotropic polypeptide receptor |
Species | Homo sapiens (Human) |
Expression System | E.coli |
Tag | N-6His |
Target Protein Sequence | RAETGSKGQTAGELYQRWERYRRECQETLAAAEPPSGLACNGSFDMYVCWDYAAPNATARASCPWYLPWHHHVAAGFVLRQCGSDGQWGLWRDHTQCENPEKNEAFLDQRLILERLQ |
Expression Range | 22-138aa |
Protein Length | Partial |
Mol. Weight | 17.5 kDa |
Research Area | Others |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | This is a receptor for GIP. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase. |
Subcellular Location | Cell membrane; Multi-pass membrane protein. |
Protein Families | G-protein coupled receptor 2 family |
Database References | HGNC: 4271 OMIM: 137241 KEGG: hsa:2696 STRING: 9606.ENSP00000467494 UniGene: PMID: 28744963 |