Recombinant Human Gap Junction Alpha-1 Protein (GJA1) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-05073P

Greater than 90% as determined by SDS-PAGE.
Recombinant Human Gap Junction Alpha-1 Protein (GJA1) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-05073P
Collections: High-quality recombinant proteins, Other recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Human Gap Junction Alpha-1 Protein (GJA1) Protein (His) is produced by our E.coli expression system. This is a cytoplasmic protein. |
Purity | Greater than 90% as determined by SDS-PAGE. |
Uniprotkb | P17302 |
Target Symbol | GJA1 |
Synonyms | GJA1; GJAL; Gap junction alpha-1 protein; Connexin-43; Cx43; Gap junction 43 kDa heart protein |
Species | Homo sapiens (Human) |
Expression System | E.coli |
Tag | N-6His |
Target Protein Sequence | FKGVKDRVKGKSDPYHATSGALSPAKDCGSQKYAYFNGCSSPTAPLSPMSPPGYKLVTGDRNNSSCRNYNKQASEQNWANYSAEQNRMGQAGSTISNSHAQPFDFPDDNQNSKKLAAGHELQPLAIVDQRPSSRASSRASSRPRPDDLEI |
Expression Range | 233-382aa |
Protein Length | Cytoplasmic Domain |
Mol. Weight | 20.3kDa |
Research Area | Signal Transduction |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | Gap junction protein that acts as a regulator of bladder capacity. A gap junction consists of a cluster of closely packed pairs of transmembrane channels, the connexons, through which materials of low MW diffuse from one cell to a neighboring cell. May play a critical role in the physiology of hearing by participating in the recycling of potassium to the cochlear endolymph. Negative regulator of bladder functional capacity: acts by enhancing intercellular electrical and chemical transmission, thus sensitizing bladder muscles to cholinergic neural stimuli and causing them to contract. May play a role in cell growth inhibition through the regulation of NOV expression and localization. Plays an essential role in gap junction communication in the ventricles. |
Subcellular Location | Cell membrane; Multi-pass membrane protein. Cell junction, gap junction. Endoplasmic reticulum. |
Protein Families | Connexin family, Alpha-type (group II) subfamily |
Database References | HGNC: 4274 OMIM: 104100 KEGG: hsa:2697 STRING: 9606.ENSP00000282561 UniGene: PMID: 27789753 |