Recombinant Human Gamma-Synuclein (SNCG) Protein (His-SUMO)

Name: Recombinant Human Gamma-Synuclein (SNCG) Protein (His-SUMO)
Brand: Beta LifeScience
SKU: BLC-03087P
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of this product could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) SNCG.

Collections: High-quality recombinant proteins, Other recombinant proteins, Recombinant proteins fall special offers - full-length proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human Gamma-Synuclein (SNCG) Protein (His-SUMO) is produced by our E.coli expression system. This is a full length protein.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	O76070
Target Symbol	SNCG
Synonyms	BCSG1; Breast cancer specific gene 1 protein; Breast cancer specific protein 1; Breast cancer-specific gene 1 protein; Gamma synuclein; Gamma-synuclein; Persyn; PRSN; SNCG; SR; Synoretin; Synuclein gamma; synuclein, gamma (breast cancer-specific protein 1); SYUG_HUMAN
Species	Homo sapiens (Human)
Expression System	E.coli
Tag	N-6His-SUMO
Target Protein Sequence	MDVFKKGFSIAKEGVVGAVEKTKQGVTEAAEKTKEGVMYVGAKTKENVVQSVTSVAEKTKEQANAVSEAVVSSVNTVATKTVEEAENIAVTSGVVRKEDLRPSAPQQEGEASKEKEEVAEEAQSGGD
Expression Range	1-127aa
Protein Length	Full Length
Mol. Weight	29.3kDa
Research Area	Neuroscience
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Plays a role in neurofilament network integrity. May be involved in modulating axonal architecture during development and in the adult. In vitro, increases the susceptibility of neurofilament-H to calcium-dependent proteases. May also function in modulating the keratin network in skin. Activates the MAPK and Elk-1 signal transduction pathway.
Subcellular Location	Cytoplasm, perinuclear region. Cytoplasm, cytoskeleton, microtubule organizing center, centrosome. Cytoplasm, cytoskeleton, spindle. Note=Associated with centrosomes in several interphase cells. In mitotic cells, localized to the poles of the spindle.
Protein Families	Synuclein family
Database References	HGNC: 11141 OMIM: 602998 KEGG: hsa:6623 STRING: 9606.ENSP00000361087 UniGene: PMID: 28035067 Results demonstrated that urine SNCG can discriminate bladder cancer from urinary diseases, and is a useful prognosticator of postsurgical recurrence. PMID: 27223068 A positive SNCG may serve as a potential marker to identify breast cancer patients who are less likely to benefit from radiotherapy PMID: 27595752 This largest collection of USCs to date demonstrates that SNCG was associated with poor survival in univariate analyses. SNCG does not predict survival outcome independent of p53 and p16 in models that jointly consider multiple markers. PMID: 27926776 SNCG expression in ovarian cancer is frequent in patients with high-risk features, but it does not correlate with chemotherapy response, overall survival, or progression-free survival. PMID: 27809878 High synoretin expression is associated with non-small cell lung cancer. PMID: 27655287 Study shows an overexpression of SNCG in bladder cancer (BC) tissues which correlates positively with neoplasm recurrence. SNCG seems a good marker to predict recurrence of BC, but not a reliable one for staging or prediction of survival rate. PMID: 26976983 down-regulation of gamma-synuclein reduces the protein level of PLCbeta but increases the transcript level over 40 fold PMID: 26521046 the conformational dynamics of ERalpha36 in the absence and presence of Hsp90 and gammaSyn, is reported. PMID: 26299756 SNCG may promote MCF7 cell migration through activating the Erk pathway and breaking cell-cell junctions. PMID: 25997706 Data suggest that both BubR1 and SNCG may be promising predictive marker rather than prognostic marker in patients with breast cancer. PMID: 26191236 High gamma-Synuclein expression is associated with invasiveness in colon adenocarcinoma. PMID: 25956278 Synuclein-gamma shares some, but not all, gene regulators with leptin and is a PPARgamma target in adipocytes but not dorsal root ganglia neurons. PMID: 25756178 These results advance our understanding of the role of lncRNA-AK058003 as a regulator of hypoxia signaling, and this newly identified hypoxia/lncRNA-AK058003/SNCG pathway may help in the development of new therapeutics. PMID: 25499222 SNCG is highly expressed in bladder cancer tissue and its expression is stage-specific, but it is not helpful for predicting outcome in bladder cancer patients. PMID: 25479371 Results indicate that SNCG specifically interacts with Akt and mTOR and protects Akt/mTOR stability and function under stressful conditions when the activity of Hsp90 is blocked. PMID: 24954510 SNCG, MAP2, SDF-1 and CXCR4 may play an important role in the carcinogenesis, progression, invasion and metastasis of gastric adenocarcinoma. PMID: 25400739 Our results are the first to suggest that SNCG is a new independent predictor for poor prognosis in EC patients in the literature. PMID: 25142230 SNCG is actively secreted by cancer cells via an unconventional secretion pathway and contributes to aggressive phenotypes of cancer cells. PMID: 25229320 These data show that SNCG renders AMD resistance by inhibiting BubR1 activity and attenuating SAC function. PMID: 24431077 even though purified gamma-synuclein form oligomers, when binding partners are present, as in cells, it dissociates to a monomer to bind these partners, which in turn may modify protein function and integrity PMID: 24367999 Data indicate that micro-RNAs might provide cell-specific regulation of gamma-synuclein expression. PMID: 24040069 SNCG expression indicates a much poorer prognosis of TNBC. PMID: 23696021 These results provide strong evidence that suggests gamma-synuclein plays a positive role in the progression of colorectal cancer. PMID: 23970348 Gamma-synuclein expression was an independent predictor of the neoadjuvant chemotherapy objective response rate. PMID: 23696593 Serum synuclein-gamma provided a promising diagnostic biomarker for early detection and was a complementary biomarker of carcinoembryonic antigen and/or CA19-9 in gastrointestinal and esophageal cancer. PMID: 22440249 Compared to controls there were lower levels of gamma synuclein in the visual cortex from dementia with Lewy bodies patients. PMID: 23242284 gamma-synuclein has a role in promoting a more robust G protein Galphaq activation of PLCbeta2 PMID: 22905097 Thermodynamic studies in conjunction with EPR confirm that alpha-synuclein, beta-synuclein, and gamma-synuclein bind copper(II) in a high affinity 1:1 stoichiometry. PMID: 21117662 SNCG can serve as a marker for the potential of the tumor cell for the rapid spreading and metastazing of the non-differentiated tumors. PMID: 22294286 SNCG biomarker has independently poor prognostic value for patients with lymph node metastasis. PMID: 22261620 Data from our in vivo study showed a decrease in tumor growth and weight in mice injected with SNCG-silenced NOZ cells. Together, these findings suggest that SNCG plays an important role in the progression of GBC PMID: 22201822 Overexpression of SNCG seemed to be a predictor biomarker for aggressive tumor behavior and adverse outcome in patients with endometrial cancer. PMID: 22015044 gamma-synuclein is a promising new adjunct marker for identifying reactive follicular dendritic cells and for diagnosing follicular dendritic cell sarcoma and benign and malignant vascular tumors. PMID: 21959308 SNCG shRNA effectively suppressed breast cancer cell formation in vivo and may be a useful clinical strategy to control breast cancer. PMID: 21740810 SNCG interacts only with the 18kDa region of Hsp70 substrate binding domain and the TPR motif of BubR1. Based on the interactions of SNCG with N-BubR1 and ANK peptide, the common residues of SNCG that mediate these interactions were identified. PMID: 20437261 The upregulation of gamma-synuclein expression in colorectal cancer is primarily attributed to the demethylation of CpG islands. PMID: 20577925 SNCG overexpression is associated with colon cancer. PMID: 20604972 Results indicate that ER-alpha36 is a new member of the ER-alpha family that mediates membrane-initiated estrogen signaling and that synuclein gamma can replace the function of heat shock protein 90. PMID: 20595634 The reciprocal regulation of gamma-synuclein and IGF-I receptor expression creates a circuit that modulates IGF-I signaling. PMID: 20670935 members of the synuclein gene family, particularly SNCA and SNCG, affect the risk of developing diffuse lewy body disease. PMID: 20697047 Gamma-synuclein protein is valuable for evaluation of progression of colorectal carcinoma; it is more sensitive to predict advanced stage and lymph node invasion when combined with either alpha- or beta-synuclein protein. PMID: 20043104 gamma-synuclein may play a positive role in the progression of colorectal cancer PMID: 19859996 Biophysical properties of the synucleins and their propensities to fibrillate: inhibition of alpha-synuclein assembly by beta- and gamma-synucleins PMID: 11812782 strong evidence that AP1 plays an overriding role in the transcription of the BCSG1 gene and that blockade of AP1 transactivation down-regulates BCSG1 expression and suppresses tumor phenotype PMID: 12072430 role in promoting cancer cell survival and inhibition of stress- and chemotherapy drug-induced apoptosis by modulating MAPK pathways PMID: 12121974 data demonstrated a moderate elevation of matrix metalloproteinases-2 and significant upregulation of matrix metalloproteinases-9 in stable cell lines overexpressing gamma-synuclein PMID: 12559990 Hypomethylation of the synuclein gamma gene CpG island promotes its aberrant expression in breast carcinoma and ovarian carcinoma. PMID: 12566312 In high-grade glial tumors. Found in all anaplastic ependymomas but in only 33% of ependymomas and 16% of myxopapillary ependymomas. In 63% of glioblastomas but not in other astrocytic tumors. No gamma-synuclein in medulloblastomas. PMID: 12783249 SNCG is required for efficient ER-alpha signaling in brest cancer. PMID: 12873981

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.