Recombinant Human Gamma-Interferon-Inducible Lysosomal Thiol Reductase (IFI30) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-00253P

Greater than 90% as determined by SDS-PAGE.
Recombinant Human Gamma-Interferon-Inducible Lysosomal Thiol Reductase (IFI30) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-00253P
Regular price
$49200
$492.00
Sale price$29900
$299.00Save $193
/
Product Overview
Description | Recombinant Human Gamma-Interferon-Inducible Lysosomal Thiol Reductase (IFI30) Protein (His) is produced by our Mammalian cell expression system. This is a protein fragment. |
Purity | Greater than 90% as determined by SDS-PAGE. |
Uniprotkb | P13284 |
Target Symbol | IFI30 |
Species | Homo sapiens (Human) |
Expression System | Mammalian cell |
Tag | C-10His |
Target Protein Sequence | MTLSPLLLFLPPLLLLLDVPTAAVQASPLQALDFFGNGPPVNYKTGNLYLRGPLKKSNAPLVNVTLYYEALCGGCRAFLIRELFPTWLLVMEILNVTLVPYGNAQEQNVSGRWEFKCQHGEEECKFNKVEACVLDELDMELAFLTIVCMEEFEDMERSLPLCLQLYAPGLSPDTIMECAMGDRGMQLMHANAQRTDALQPPHEYVPWVTVNGKPLEDQTQLLTLVCQLYQGK |
Expression Range | 1-232aa |
Protein Length | Partial |
Mol. Weight | 27.4 kDa |
Research Area | Immunology |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | Lysosomal thiol reductase that can reduce protein disulfide bonds. May facilitate the complete unfolding of proteins destined for lysosomal degradation. Plays an important role in antigen processing. Facilitates the generation of MHC class II-restricted epitodes from disulfide bond-containing antigen by the endocytic reduction of disulfide bonds. Facilitates also MHC class I-restricted recognition of exogenous antigens containing disulfide bonds by CD8+ T-cells or crosspresentation. |
Subcellular Location | Secreted. Lysosome. |
Protein Families | GILT family |
Database References |
Gene Functions References
- Results shows that GILT expression is required for downregulation of PAX-3 proteins in late stage human melanoma cells. GILT co-localizes with PAX-3 proteins regulating its expression through the autophagy and lysosomal degradation pathway in human melanoma cells. PMID: 28857256
- GILT functions as a host restriction factor against the retroviruses. PMID: 27655726
- GILT expression is anticipated to result in improved presentation of melanoma antigens and more effective antimelanoma T-cell responses. PMID: 26930048
- The lysosomal thiol reductase GILT expressed by antigen-presenting cells has diverse cellular and organismal functions. (Review) PMID: 26116226
- this review discusses recent studies that have advanced our understanding of the role of GILT in antigen processing and revealed surprising new functions for the enzyme.[review] PMID: 23246037
- Single nucleotide polymorphism of the interferon-gamma-inducible protein 30 gene is associated with hyperglycemia in severely obese individuals. PMID: 21701784
- GILT is required for efficient histocompatiblity class II-restricted processing of melanoma antigen tyrosinase-related protein 1 epitope in vitro and accelerates the onset of vitiligo in TRP1-specific T-cell receptor transgenic mice. PMID: 20668223
- Absence of gamma-interferon-inducible lysosomal thiol reductase in melanomas disrupts T cell recognition of select immunodominant epitopes. PMID: 12021307
- Role of the C-terminal propeptide in the activity and maturation of gamma -interferon-inducible lysosomal thiol reductase (GILT). PMID: 12198183
- GILT-expressing melanoma cells could prove to be very promising for direct antigen presentation and CD4+ T cell recognition PMID: 18343923
- studied gene expression profile of brain lesions of a patient with Neuromyelitis optica by using DNA microarray; found marked up-regulation of interferon gamma-inducible protein 30 (IFI30), CD163, and secreted phosphoprotein 1 (SPP1, osteopontin) PMID: 18410276