Recombinant Human Gamma-Aminobutyric Acid Receptor Subunit Alpha-4 (GABRA4) Protein (His-SUMO)
Beta LifeScience
SKU/CAT #: BLC-08565P
Greater than 90% as determined by SDS-PAGE.
Recombinant Human Gamma-Aminobutyric Acid Receptor Subunit Alpha-4 (GABRA4) Protein (His-SUMO)
Beta LifeScience
SKU/CAT #: BLC-08565P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Human Gamma-Aminobutyric Acid Receptor Subunit Alpha-4 (GABRA4) Protein (His-SUMO) is produced by our E.coli expression system. This is a extracellular protein. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Uniprotkb | P48169 |
| Target Symbol | GABRA4 |
| Synonyms | GABA(A) receptor subunit alpha 4; GABA(A) receptor subunit alpha-4; GABR A4; GABRA 4; Gabra4; Gamma aminobutyric acid (GABA) A receptor alpha 4; Gamma aminobutyric acid A receptor alpha 4; Gamma aminobutyric acid receptor alpha 4 subunit; Gamma aminobutyric acid receptor subunit alpha 4; Gamma-aminobutyric acid receptor subunit alpha-4; GBRA4_HUMAN |
| Species | Homo sapiens (Human) |
| Expression System | E.coli |
| Tag | N-6His-SUMO |
| Target Protein Sequence | QNQKEEKLCTENFTRILDSLLDGYDNRLRPGFGGPVTEVKTDIYVTSFGPVSDVEMEYTMDVFFRQTWIDKRLKYDGPIEILRLNNMMVTKVWTPDTFFRNGKKSVSHNMTAPNKLFRIMRNGTILYTMRLTISAECPMRLVDFPMDGHACPLKFGSYAYPKSEMIYTWTKGPEKSVEVPKESSSLVQYDLIGQTVSSETIKSITGEYIVMTVYFHLRRKMGY |
| Expression Range | 36-258aa |
| Protein Length | Extracellular Domain |
| Mol. Weight | 41.8kDa |
| Research Area | Neuroscience |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | GABA, the major inhibitory neurotransmitter in the vertebrate brain, mediates neuronal inhibition by binding to the GABA/benzodiazepine receptor and opening an integral chloride channel. |
| Subcellular Location | Cell junction, synapse, postsynaptic cell membrane; Multi-pass membrane protein. Cell membrane; Multi-pass membrane protein. |
| Protein Families | Ligand-gated ion channel (TC 1.A.9) family, Gamma-aminobutyric acid receptor (TC 1.A.9.5) subfamily, GABRA4 sub-subfamily |
| Database References | HGNC: 4078 OMIM: 137141 KEGG: hsa:2557 STRING: 9606.ENSP00000264318 UniGene: PMID: 26239769 |
