Recombinant Human Gamma-Aminobutyric Acid Receptor-Associated Protein-Like 2 (GABARAPL2) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-06432P

Greater than 90% as determined by SDS-PAGE.
Recombinant Human Gamma-Aminobutyric Acid Receptor-Associated Protein-Like 2 (GABARAPL2) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-06432P
Collections: High-quality recombinant proteins, Other recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Human Gamma-Aminobutyric Acid Receptor-Associated Protein-Like 2 (GABARAPL2) Protein (His) is produced by our E.coli expression system. This is a full length protein. |
Purity | Greater than 90% as determined by SDS-PAGE. |
Uniprotkb | P60520 |
Target Symbol | GABARAPL2 |
Species | Homo sapiens (Human) |
Expression System | E.coli |
Tag | C-6His |
Target Protein Sequence | MKWMFKEDHSLEHRCVESAKIRAKYPDRVPVIVEKVSGSQIVDIDKRKYLVPSDITVAQFMWIIRKRIQLPSEKAIFLFVDKTVPQSSLTMGQLYEKEKDEDGFLYVAYSGENTFGF |
Expression Range | 1-117aa |
Protein Length | Full Length |
Mol. Weight | 14.6 kDa |
Research Area | Transport |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | Ubiquitin-like modifier involved in intra-Golgi traffic. Modulates intra-Golgi transport through coupling between NSF activity and SNAREs activation. It first stimulates the ATPase activity of NSF which in turn stimulates the association with GOSR1. Involved in autophagy. Plays a role in mitophagy which contributes to regulate mitochondrial quantity and quality by eliminating the mitochondria to a basal level to fulfill cellular energy requirements and preventing excess ROS production. Whereas LC3s are involved in elongation of the phagophore membrane, the GABARAP/GATE-16 subfamily is essential for a later stage in autophagosome maturation. |
Subcellular Location | Cytoplasmic vesicle, autophagosome. Endoplasmic reticulum membrane. Golgi apparatus. |
Protein Families | ATG8 family |
Database References | HGNC: 13291 OMIM: 607452 KEGG: hsa:11345 STRING: 9606.ENSP00000037243 UniGene: PMID: 29544880 |