Recombinant Human Gamma-Aminobutyric Acid Receptor-Associated Protein-Like 2 (GABARAPL2) Protein (GST)

Beta LifeScience SKU/CAT #: BLC-08462P
Greater than 90% as determined by SDS-PAGE.
Greater than 90% as determined by SDS-PAGE.

Recombinant Human Gamma-Aminobutyric Acid Receptor-Associated Protein-Like 2 (GABARAPL2) Protein (GST)

Beta LifeScience SKU/CAT #: BLC-08462P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description Recombinant Human Gamma-Aminobutyric Acid Receptor-Associated Protein-Like 2 (GABARAPL2) Protein (GST) is produced by our E.coli expression system. This is a full length protein.
Purity Greater than 90% as determined by SDS-PAGE.
Uniprotkb P60520
Target Symbol GABARAPL2
Synonyms ATG8; ATG8C; FLC3A; GABA(A) receptor-associated protein-like 2; Gabarapl2; Gamma-aminobutyric acid receptor-associated protein-like 2; Ganglioside expression factor 2; GATE-16; GATE16; GBRL2_HUMAN; GEF-2; GEF2; General protein transport factor p16; Golgi-associated ATPase enhancer of 16 kDa; MAP1 light chain 3-related protein
Species Homo sapiens (Human)
Expression System E.coli
Tag N-GST
Target Protein Sequence MKWMFKEDHSLEHRCVESAKIRAKYPDRVPVIVEKVSGSQIVDIDKRKYLVPSDITVAQFMWIIRKRIQLPSEKAIFLFVDKTVPQSSLTMGQLYEKEKDEDGFLYVAYSGENTFGF
Expression Range 1-117aa
Protein Length Full Length
Mol. Weight 40.7kDa
Research Area Transport
Form Liquid or Lyophilized powder
Buffer Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function Ubiquitin-like modifier involved in intra-Golgi traffic. Modulates intra-Golgi transport through coupling between NSF activity and SNAREs activation. It first stimulates the ATPase activity of NSF which in turn stimulates the association with GOSR1. Involved in autophagy. Plays a role in mitophagy which contributes to regulate mitochondrial quantity and quality by eliminating the mitochondria to a basal level to fulfill cellular energy requirements and preventing excess ROS production. Whereas LC3s are involved in elongation of the phagophore membrane, the GABARAP/GATE-16 subfamily is essential for a later stage in autophagosome maturation.
Subcellular Location Cytoplasmic vesicle, autophagosome. Endoplasmic reticulum membrane. Golgi apparatus.
Protein Families ATG8 family
Database References

HGNC: 13291

OMIM: 607452

KEGG: hsa:11345

STRING: 9606.ENSP00000037243

UniGene: PMID: 29544880

  • Mechanism of cargo-directed Atg8 conjugation during selective autophagy has been described. PMID: 27879200
  • rs12599322 in ATG8 was significantly associated with higher DNA damage levels in Chinese population. PMID: 28512061
  • describe a protocol for the reconstituted conjugation systems for mammalian Atg8 homologs in vitro using purified recombinant Atg proteins and liposomes. PMID: 25181299
  • Using X-ray crystallography and NMR spectroscopy, the structural transition centered on the C-terminus of GATE-16 protein was identified. PMID: 26284781
  • Results showed that the mRNA and protein levels of GABARAPL1 and GATE-16 were decreased in the cerebellum of multiple system atrophy relative to controls PMID: 22959883
  • Lipidation of the LC3/GABARAP family of autophagy proteins relies on a membrane-curvature-sensing domain in Atg3. PMID: 24747438
  • these results suggest that TRPML3 plays a role in autophagosome maturation through the interaction with GATE16, by providing Ca(2+) in the fusion process. PMID: 24269818
  • low GABARAPL2/GATE-16 expression is associated with an immature myeloid leukemic phenotype and these proteins are necessary for neutrophil differentiation of APL cells PMID: 23891751
  • TP53INP1, a tumor suppressor, interacts with LC3 and ATG8-family proteins through the LC3-interacting region (LIR) and promotes autophagy-dependent cell death. PMID: 22421968
  • ATG8 proteins act as scaffolds for assembly of the ULK complex at the phagophore PMID: 23043107
  • Legionella pneumophila could interfere with autophagy by using the bacterial effector protein RavZ to directly uncouple Atg8 proteins attached to phosphatidylethanolamine on autophagosome membranes. [RavZ] PMID: 23112293
  • Binding of the Atg1/ULK1 kinase to the ubiquitin-like protein Atg8 regulates autophagy PMID: 22885598
  • identified 14 TBC domain-containing Rab GAPs that bind directly to ATG8 modifiers and that colocalize with LC3-positive autophagy membranes in cells PMID: 22354992
  • ORP7 negatively regulates GS28 protein stability via sequestration of GATE-16, and may mediate the effect of 25-OH on GS28 and Golgi function. PMID: 21669198
  • The GATE-16 N termini in general and specific residues needed for the fusion activity are essential for the proteins role in autophagosome biogenesis. PMID: 21497758
  • Atg4B possessed the broadest spectrum against all substrates, followed by Atg4A for ATG8 substrates PMID: 21177865
  • The results indicate the essential role of the Atg8 system in the proper development of autophagic isolation membranes in mice. PMID: 18768753
  • The autophagy-unrelated association of GFP-LC3 with protein aggregates is dependent on its interaction with p62. PMID: 18776740
  • FAQs

    Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

    Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

    Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

    Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

    Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

    Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

    To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.

    Recently viewed