Recombinant Human Gamma-Aminobutyric Acid Receptor-Associated Protein-Like 1 (GABARAPL1) Protein (GST)

Name: Recombinant Human Gamma-Aminobutyric Acid Receptor-Associated Protein-Like 1 (GABARAPL1) Protein (GST)
Brand: Beta LifeScience
SKU: BLC-03718P
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Collections: High-quality recombinant proteins, Other recombinant proteins, Recombinant proteins fall special offers - full-length proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human Gamma-Aminobutyric Acid Receptor-Associated Protein-Like 1 (GABARAPL1) Protein (GST) is produced by our E.coli expression system. This is a full length protein.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	Q9H0R8
Target Symbol	GABARAPL1
Synonyms	APG8 like; APG8L; ATG8; ATG8B; ATG8L; Early estrogen regulated protein; Early estrogen-regulated protein; GABA; GABA(A) receptor associated protein like 1; GABA(A) receptor-associated protein-like 1; GABARAPL1 a; GABARAPL1; Gamma aminobutyric acid receptor associated protein like 1; Gamma-aminobutyric acid receptor-associated protein-like 1; GBRL1_HUMAN; GEC 1; GEC-1; GEC1; Glandular epithelial cell protein 1
Species	Homo sapiens (Human)
Expression System	E.coli
Tag	N-GST
Target Protein Sequence	MKFQYKEDHPFEYRKKEGEKIRKKYPDRVPVIVEKAPKARVPDLDKRKYLVPSDLTVGQFYFLIRKRIHLRPEDALFFFVNNTIPPTSATMGQLYEDNHEEDYFLYVAYSDESVYG
Expression Range	1-117aa
Protein Length	Full Length
Mol. Weight	40.9kDa
Research Area	Neuroscience
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Ubiquitin-like modifier that increases cell-surface expression of kappa-type opioid receptor through facilitating anterograde intracellular trafficking of the receptor. Involved in formation of autophagosomal vacuoles. While LC3s are involved in elongation of the phagophore membrane, the GABARAP/GATE-16 subfamily is essential for a later stage in autophagosome maturation. Through its interaction with the reticulophagy receptor TEX264, participates in the remodeling of subdomains of the endoplasmic reticulum into autophagosomes upon nutrient stress, which then fuse with lysosomes for endoplasmic reticulum turnover.
Subcellular Location	Cytoplasmic vesicle, autophagosome. Cytoplasmic vesicle membrane; Lipid-anchor. Cytoplasm, cytoskeleton. Endoplasmic reticulum. Golgi apparatus.
Protein Families	ATG8 family
Database References	HGNC: 4068 OMIM: 607420 KEGG: hsa:23710 STRING: 9606.ENSP00000266458 UniGene: PMID: 27623937 Our data demonstrated that a specific decrease of GABARAPL1 expression in breast cancers was associated with both DNA methylation and histone deacetylation and that CREB-1 recruitment on GABARAPL1 PMID: 26474850 Androgen deprivation downregulates Gabarapl1 in an AR dependent manner, resulting in the increase of autophagy flux PMID: 26050226 GABARAPL1 plays an important role in cell proliferation, invasion, and autophagic flux, as well as in mitochondrial homeostasis and cellular metabolic programs in a breast cancer cell line. PMID: 24879149 Kaplan-Meier survival analysis showed a significant association between low GABARAPL1 expression and poor prognosis of HCC patients. PMID: 24647565 Data demonstrate that HSP90 interacts and protects GABARAPL1 from its degradation by the proteasome. PMID: 22120110 analysis of specific functions of GABARAPL1 [review] PMID: 21597319 Atg8 interacting motif (AIM) in Stbd1 is necessary for GABARAPL1 binding. PMID: 21893048 Results indicate that the presence of a tryptophan residue in the LIR motif increases the binding affinity of GABARAPL-1/NBR1-LIR complex. PMID: 21620860 Gabarapl1 mRNA expression in breast tumours is a good indicator of the risk of recurrence, specifically in lymph nodes positive patients. PMID: 20197771 GEC1 interacts with the kappa opioid receptor and enhances expression of the receptor PMID: 16431922 GEC1-kappa opioid receptor binding involves hydrophobic interactions: GEC1 has chaperone-like effect. PMID: 19001416 Caspase cleavage of Atg4D stimulates GABARAP-L1 processing and triggers mitochondrial targeting and apoptosis. PMID: 19549685

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.