Recombinant Human Gamma-Aminobutyric Acid Receptor-Associated Protein (GABARAP) Protein (GST)
Beta LifeScience
SKU/CAT #: BLC-08422P

Greater than 90% as determined by SDS-PAGE.
Recombinant Human Gamma-Aminobutyric Acid Receptor-Associated Protein (GABARAP) Protein (GST)
Beta LifeScience
SKU/CAT #: BLC-08422P
Collections: High-quality recombinant proteins, Other recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Human Gamma-Aminobutyric Acid Receptor-Associated Protein (GABARAP) Protein (GST) is produced by our E.coli expression system. This is a protein fragment. |
Purity | Greater than 90% as determined by SDS-PAGE. |
Uniprotkb | O95166 |
Target Symbol | GABARAP |
Synonyms | ATG8A; FLC 3B; FLC3B; FLJ25768; GABA type A receptor associated protein; GABA(A) receptor associated protein; GABA(A) receptor-associated protein; GABARAP a; GABARAP; Gamma aminobutyric acid receptor associated protein; Gamma-aminobutyric acid receptor-associated protein; GBRAP_HUMAN; MGC120154; MGC120155; MM 46; MM46 |
Species | Homo sapiens (Human) |
Expression System | E.coli |
Tag | N-GST |
Target Protein Sequence | KFVYKEEHPFEKRRSEGEKIRKKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQFYFLIRKRIHLRAEDALFFFVNNVIPPTSATMGQLYQEHHEEDFFLYIAYSDESVYGL |
Expression Range | 2-117aa |
Protein Length | Partial |
Mol. Weight | 40.8kDa |
Research Area | Transport |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | Ubiquitin-like modifier that plays a role in intracellular transport of GABA(A) receptors and its interaction with the cytoskeleton. Involved in autophagy: while LC3s are involved in elongation of the phagophore membrane, the GABARAP/GATE-16 subfamily is essential for a later stage in autophagosome maturation. Through its interaction with the reticulophagy receptor TEX264, participates in the remodeling of subdomains of the endoplasmic reticulum into autophagosomes upon nutrient stress, which then fuse with lysosomes for endoplasmic reticulum turnover. Also required for the local activition of the CUL3(KBTBD6/7) E3 ubiquitin ligase complex, regulating ubiquitination and degradation of TIAM1, a guanyl-nucleotide exchange factor (GEF) that activates RAC1 and downstream signal transduction. Thereby, regulates different biological processes including the organization of the cytoskeleton, cell migration and proliferation. Involved in apoptosis. |
Subcellular Location | Endomembrane system. Cytoplasm, cytoskeleton. Golgi apparatus membrane. Cytoplasmic vesicle, autophagosome. Cytoplasmic vesicle. |
Protein Families | ATG8 family |
Database References | HGNC: 4067 OMIM: 605125 KEGG: hsa:11337 STRING: 9606.ENSP00000306866 UniGene: PMID: 28990689 |