Recombinant Human Galectin-7 (LGALS7) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-08334P
Greater than 90% as determined by SDS-PAGE.
Recombinant Human Galectin-7 (LGALS7) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-08334P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Human Galectin-7 (LGALS7) Protein (His) is produced by our E.coli expression system. This is a full length protein. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Uniprotkb | P47929 |
| Target Symbol | LGALS7 |
| Synonyms | Gal-7; GAL7; Galectin 7B; Galectin-7; HKL-14; Human keratinocyte lectin 14 ; Keratinocyte lectin 14; Lectin galactoside binding soluble 7; Lectin; galactoside binding; soluble; 7B; LEG7_HUMAN; LGALS7; LGALS7A; LGALS7B; P53 induced protein 1; p53-induced gene 1 protein; Pi7; PIG1; TP53I1 |
| Species | Homo sapiens (Human) |
| Expression System | E.coli |
| Tag | N-6His |
| Target Protein Sequence | SNVPHKSSLPEGIRPGTVLRIRGLVPPNASRFHVNLLCGEEQGSDAALHFNPRLDTSEVVFNSKEQGSWGREERGPGVPFQRGQPFEVLIIASDDGFKAVVGDAQYHHFRHRLPLARVRLVEVGGDVQLDSVRIF |
| Expression Range | 2-136aa |
| Protein Length | Full Length of Mature Protein |
| Mol. Weight | 18.9kDa |
| Research Area | Neuroscience |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Could be involved in cell-cell and/or cell-matrix interactions necessary for normal growth control. Pro-apoptotic protein that functions intracellularly upstream of JNK activation and cytochrome c release. |
| Subcellular Location | Cytoplasm. Nucleus. Secreted. Note=May be secreted by a non-classical secretory pathway. |
| Database References | HGNC: 6568 OMIM: 600615 KEGG: hsa:3963 STRING: 9606.ENSP00000367891 UniGene: PMID: 28526214 |
