Recombinant Human G2/Mitotic-Specific Cyclin-B1 (CCNB1) Protein (His)

Beta LifeScience SKU/CAT #: BLC-07151P
Greater than 90% as determined by SDS-PAGE.
Greater than 90% as determined by SDS-PAGE.

Recombinant Human G2/Mitotic-Specific Cyclin-B1 (CCNB1) Protein (His)

Beta LifeScience SKU/CAT #: BLC-07151P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description Recombinant Human G2/Mitotic-Specific Cyclin-B1 (CCNB1) Protein (His) is produced by our E.coli expression system. This is a full length protein.
Purity Greater than 90% as determined by SDS-PAGE.
Uniprotkb P14635
Target Symbol CCNB1
Species Homo sapiens (Human)
Expression System E.coli
Tag N-6His
Target Protein Sequence MALRVTRNSKINAENKAKINMAGAKRVPTAPAATSKPGLRPRTALGDIGNKVSEQLQAKMPMKKEAKPSATGKVIDKKLPKPLEKVPMLVPVPVSEPVPEPEPEPEPEPVKEEKLSPEPILVDTASPSPMETSGCAPAEEDLCQAFSDVILAVNDVDAEDGADPNLCSEYVKDIYAYLRQLEEEQAVRPKYLLGREVTGNMRAILIDWLVQVQMKFRLLQETMYMTVSIIDRFMQNNCVPKKMLQLVGVTAMFIASKYEEMYPPEIGDFAFVTDNTYTKHQIRQMEMKILRALNFGLGRPLPLHFLRRASKIGEVDVEQHTLAKYLMELTMLDYDMVHFPPSQIAAGAFCLALKILDNGEWTPTLQHYLSYTEESLLPVMQHLAKNVVMVNQGLTKHMTVKNKYATSKHAKISTLPQLNSALVQDLAKAVAKV
Expression Range 1-433aa
Protein Length Full Length
Mol. Weight 52.4 kDa
Research Area Cell Biology
Form Liquid or Lyophilized powder
Buffer Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function Essential for the control of the cell cycle at the G2/M (mitosis) transition.
Subcellular Location Cytoplasm. Nucleus. Cytoplasm, cytoskeleton, microtubule organizing center, centrosome.
Protein Families Cyclin family, Cyclin AB subfamily
Database References

HGNC: 1579

OMIM: 123836

KEGG: hsa:891

STRING: 9606.ENSP00000256442

UniGene: PMID: 29705704

  • SNAP23 suppressed progression of cervical cancer and induced cell cycle G2/M arrest via upregulating p21(cip1) and downregulating CyclinB1 PMID: 29908998
  • Defective cyclin B1 induction by T-DM1 mediates acquired resistance in HER2-positive breast cancer cells. PMID: 28821558
  • Up-regulation of CCNB1 could be an indicator for invasiveness of pituitary adenomas.Up-regulation of CCNB1 could be an indicator for invasiveness of pituitary adenomas. PMID: 28601573
  • We identified the known APC/C regulator Cdh1 and the F-box protein Fbxl15 as specific modulators of N-cyclin B1-luciferase steady-state levels and turnover. Collectively, our studies suggest that analyzing the steady-state levels of luciferase fusion proteins in parallel facilitates identification of specific regulators of protein turnover. PMID: 28296622
  • Overexpression of cyclin B1 is correlated with poor survival in most solid tumors, which suggests that the expression status of cyclin B1 is a significant prognostic parameter in solid tumors. [review] PMID: 27903976
  • CDK9, in addition to CDK1, has roles in mediating the growth inhibitory effect of dinaciclib on cyclin B1 in triple negative breast cancer PMID: 27486754
  • Data show that Islet-1 (ISL1) activated the expression of cyclin B1 (CCNB1), cyclin B2 (CCNB2) and c-myc (c-MYC) genes by binding to the conserved binding sites on their promoters or enhancers. PMID: 27183908
  • XIAP is stable during mitotic arrest, but its function is controlled through phosphorylation by the mitotic kinase CDK1-cyclin-B1 at S40. PMID: 27927753
  • ZIC5 is highly upregulated in non-small cell lung cancer tumor tissues and may act as an oncogene by influencing CCNB1 and CDK1 complex expression PMID: 27663664
  • Knockdown of DRG2 elicited down-regulation of the major mitotic promoting factor, the cyclin B1/Cdk1 complex. PMID: 27669826
  • Mitochondrial Ribosomal Protein L10 regulates cyclin B1/Cdk1 (cyclin-dependent kinase 1) activity and mitochondrial protein synthesis in mammalian cells PMID: 27726420
  • Changes in expression and localization of cyclin B1 may constitute a part of the mechanism responsible for resistance of HL-60 cells to etoposide. PMID: 27297620
  • Data suggest that long non-coding RNA ZFAS1 may function as oncogene via destabilization of tumor suppressor protein p53 (p53) and through cyclin-dependent kinase 1 (CDK1)/cyclin B1 complex leading to cell cycle progression and inhibition of apoptosis. PMID: 26506418
  • exposing renal carcinoma cells to amygdalin inhibited cell cycle progression and tumor cell growth by impairing cdk1 and cyclin B expression PMID: 26709398
  • Sodium butyrate accelerates 3' UTR-dependent cyclin B1 decay by enhancing the binding of tristetraprolin to the 3' untranslated region of cyclin B1. PMID: 26555753
  • CDK1-Cyclin B1 activates RNMT, coordinating mRNA cap methylation with G1 phase transcription. PMID: 26942677
  • Our results demonstrate for the first time that the SYSADOA diacerein decreased the viability of human chondrosarcoma cells and induces G2/M cell cycle arrest by CDK1/cyclin B1 down-regulation. PMID: 26555773
  • CCNB1 is target of miRNA-410 since its overexpression reduces CCNB1 at protein and mRNA levels. PMID: 26125663
  • Germ cell tumors consistently overexpressed cyclin B1 independently of their responsiveness to chemotherapy or the presence of p53 mutations. Cyclin B1 was overexpressed by GCT cell lines carrying functional p53. PMID: 25982682
  • The authors postulate that the mechanism of cytomegalovirus pUL97-human cyclin B1 interaction is determined by an active pUL97 kinase domain. PMID: 26270673
  • Stereospecific phosphorylation of only the Ser-trans-Pro peptide by Cdk1-cyclin B1 PMID: 25603287
  • Pharmacological inhibition or siRNA-mediated knockdown of cdk1/CCNB1 induced proliferation arrest independent of MYCN status in neuroblastoma cells. PMID: 26029996
  • Expression of CDK1 Tyr15, pCDK1 Thr161, Cyclin B1 (total) and pCyclin B1 Ser126 in vulvar squamous cell carcinoma and their relations with clinicopatological features and prognosis. PMID: 25849598
  • BUB1B expression was highly correlated to CDC20 and CCNB1 expression in multiple myeloma cells, leading to increased cell proliferation. PMID: 25698537
  • Proximity ligation assay demonstrate proximity between S100A4 and cyclin B1 in vitro, while confocal microscopy showed S100A4 to localize to areas corresponding to centrosomes in mitotic cells prior to chromosome segregation. PMID: 26349943
  • Cyclin B1 could suppress the invasion and metastasis of colorectal cancer cells through regulating E-cadherin expression, which enables the development of potential intervention strategies for colorectal cancer. PMID: 25962181
  • CCNB1 is a biomarker for the prognosis of ER+ breast cancer and monitoring of hormone therapy efficacy PMID: 25044212
  • that CCNB1 contained many CD4 T cell epitopes, which are differentially recognized by pre-existing naive and memory CD4 T cells. PMID: 26136431
  • CCNB1 activation is associated with recurrence in non-muscle-invasive bladder cancer. PMID: 24714775
  • PKCa and Cyclin B1 are linked in a DAG-dependent mechanism that regulates cell cycle progression PMID: 25362646
  • Complete removal of cyclin B1 is essential to prevent the return of the spindle checkpoint following sister chromatid disjunction. PMID: 25483188
  • Data show that inappropriate overexpression of cyclin B1 causes non-specific cell death. PMID: 25415322
  • Cyclin B1 marks the restriction point for permanent cell cycle exit in G2 phase. PMID: 25486360
  • CCNB1 is activated by Chk1, exerts its oncogenic role in colorectal cancer cells, and may play a key role in the development of a novel therapeutic approach against colorectal cancer. PMID: 24971465
  • Stable association of Cdk1-cyclin B1 with phosphorylated separase counteracts this tendency and stabilizes separase in an inhibited yet activatable state PMID: 25659430
  • the results were indicative that cyclin B may hold independent prognostic significance, but further studies are required to assess this. PMID: 25315186
  • that MAD2B may play an important role in high glucose-mediated podocyte injury of diabetic nephropathy via modulation of Cdh1, cyclin B1, and Skp2 expression PMID: 25651564
  • Expression of cycle marker cyclin B1 differs between benign and malignant papillary breast lesions. PMID: 25501285
  • Phosphorylated Akt plays an important role in regulating the expression level of cyclin B1 by interacting with AR and increasing the transcriptional activity of AR. PMID: 24574517
  • Cyclin B1 expression was studied immunohistochemically in specimens from 241 patients with pancreatic cancer and was correlated with clinicopathological features and patient survival. PMID: 25106528
  • Cyclin B1 overexpression is associated with medullary thyroid carcinoma. PMID: 24488334
  • study indicates that genetic polymorphisms of CCNB1 and CDK1 are related to BC susceptibility, progression, and survival in Chinese Han women. PMID: 24386390
  • Parvovirus-induced depletion of cyclin B1 prevents mitotic entry of infected cells. PMID: 24415942
  • our data suggest that the non-canonical Hh pathway mediated through ptch1 and cyclin B1 is involved in the pathogenesis of NBCCS-associated KCOTs. PMID: 24840883
  • Allele-dependent transcriptional regulation of CCNB1 associated with the SNPs rs350099, rs350104, and rs164390 affects ISR risk through differential recruitment of NF-Y, AP-1, and SP1. PMID: 24395923
  • Cyclin B1 and cyclin B2 are interchangeable for ability to promote G2 and M transition in HeLa cells. PMID: 24324638
  • Our results indicated that CDB(cyclin B destruction box )-fused fluorescent protein can be used to examine the slight gene regulations in the reporter gene system PMID: 24416725
  • The cyclin B 3'UTR was not sufficient to enhance cyclin B synthesis. PMID: 24058555
  • Cyclin B1/Cdk1-mediated phosphorylation of mitochondrial substrates allows cells to sense and respond to increased energy demand for G2/M transition and, subsequently, to upregulate mitochondrial respiration for successful cell-cycle progression. PMID: 24746669
  • FAQs

    Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

    Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

    Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

    Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

    Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

    Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

    To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.

    Recently viewed