Recombinant Human G1/S-Specific Cyclin-D3 (CCND3) Protein (GST)

Name: Recombinant Human G1/S-Specific Cyclin-D3 (CCND3) Protein (GST)
Brand: Beta LifeScience
SKU: BLC-09250P
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Product Overview

Description	Recombinant Human G1/S-Specific Cyclin-D3 (CCND3) Protein (GST) is produced by our E.coli expression system. This is a full length protein.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	P30281
Target Symbol	CCND3
Synonyms	CCND 3; Ccnd3; CCND3_HUMAN; CyclinD3; D3 type cyclin; G1 S specific cyclin D3; G1/S specific cyclin D3; G1/S-specific cyclin-D3
Species	Homo sapiens (Human)
Expression System	E.coli
Tag	N-GST
Target Protein Sequence	MELLCCEGTRHAPRAGPDPRLLGDQRVLQSLLRLEERYVPRASYFQCVQREIKPHMRKMLAYWMLEVCEEQRCEEEVFPLAMNYLDRYLSCVPTRKAQLQLLGAVCMLLASKLRETTPLTIEKLCIYTDHAVSPRQLRDWEVLVLGKLKWDLAAVIAHDFLAFILHRLSLPRDRQALVKKHAQTFLALCATDYTFAMYPPSMIATGSIGAAVQGLGACSMSGDELTELLAGITGTEVDCLRACQEQIEAALRESLREASQTSSSPAPKAPRGSSSQGPSQTSTPTDVTAIHL
Expression Range	1-292aa
Protein Length	Full Length
Mol. Weight	59.5kDa
Research Area	Cell Biology
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Regulatory component of the cyclin D3-CDK4 (DC) complex that phosphorylates and inhibits members of the retinoblastoma (RB) protein family including RB1 and regulates the cell-cycle during G(1)/S transition. Phosphorylation of RB1 allows dissociation of the transcription factor E2F from the RB/E2F complex and the subsequent transcription of E2F target genes which are responsible for the progression through the G(1) phase. Hypophosphorylates RB1 in early G(1) phase. Cyclin D-CDK4 complexes are major integrators of various mitogenenic and antimitogenic signals. Component of the ternary complex, cyclin D3/CDK4/CDKN1B, required for nuclear translocation and activity of the cyclin D-CDK4 complex. Shows transcriptional coactivator activity with ATF5 independently of CDK4.
Subcellular Location	Nucleus. Cytoplasm.
Protein Families	Cyclin family, Cyclin D subfamily
Database References	HGNC: 1585 OMIM: 123834 KEGG: hsa:896 STRING: 9606.ENSP00000362082 UniGene: Hs.534307

Gene Functions References

The Novel Short Isoform of Securin Stimulates the Expression of Cyclin D3 and Angiogenesis Factors VEGFA and FGF2, but Does Not Affect the Expression of MYC Transcription Factor PMID: 29989583
miR-212 exerts growth-suppressive effects in Adult T-cell leukemia/lymphoma (ATL) cells largely by targeting CCND3 and may have therapeutic potential in ATL. PMID: 27493231
Cyclin D3 is expressed in the majority of splenic diffuse red pulp small B-cell lymphomas. Increased expression is sometimes the result of somatic mutations in the PEST domain of the CCND3 gene. PMID: 28069605
in ovarian cancer cells, DOT1L regulates the transcription of G1 phase genes CDK6 and CCND3 through H3K79 dimethylation PMID: 28114995
metabolic function of cyclin D3-CDK6 kinase in cancer cell survival PMID: 28607489
we showed that ZNF224 positively modulates cyclin D3 gene expression. Consistently, we observed that alteration of ZNF224 expression leads to defects in cell cycle control. All together, our results strongly suggest that in Chronic lymphocytic leukaemia (CLL)cells high expression level of ZNF224 can lead to inappropriate cell growth and apoptosis resistance, thus contributing to CLL progression PMID: 28040726
the activation of TLR7 increased CCND3 expression via the downregulation of miR-15b in B cells. PMID: 26144250
This study describes the identification and characterization of cyclin D3 as a novel interactor of influenza A virus M2 protein. PMID: 28130444
MicroRNA-138 interacts with cyclin D3 and negatively regulates non-small cell lung cancer cells PMID: 26201895
Combined urinary FGFR3/Cyclin D3 expression shows improved detection rates for bladder cancer recurrence with high specificity and sensitivity. PMID: 26861974
The CDK6-cyclin D3 pair play a fundamental role in controlling CDK2-dependent SAMHD1 phosphorylation and the dNTP pool in primary macrophages. PMID: 25927932
Two recurrent fusion genes associated with the 12q locus, LRP1-SNRNP25 and KCNMB4-CCND3, were by RT-PCR, Sanger sequencing and FISH, and were found to be osteosarcoma specific in a validation cohort of 240 other sarcomas. PMID: 25300797
G1 arrest induced by SB265610 occurred at concentrations lacking CXCR2 selectivity and revealed cyclin-dependent kinase 2 (CDK2) (Thr160) hypophosphorylation, cyclin D3 gene down-regulation, and p21 post-translational induction PMID: 26026083
sLZIP regulates the transcription of cyclin D3 by binding directly to the AP-1 region in the cyclin D3 promoter. PMID: 24441043
combined expression of miR-138 and its direct target CCND3 may be correlated with significant characteristics of hepatocellular carcinoma PMID: 25439221
Namely the amplification of the expression of the PLCB1a, but not of PLCB1b, is able to maintain high levels of expression of cyclin D3 even after treatment with kinamycin F PMID: 25160985
cell cycle related proteins PCNA, Ki67, cyclin D3, p27 and p57 were expressed in both normal and diabetic human term placentas. PMID: 23963898
two cell cycle-related molecules, cyclin D3 and E2F3, were identified as the direct miR-503 targets. PMID: 23967867
PCNSL prognosis is relatively poor. Age, high tumor burden, higher lymphocyte count, expression of Cyclin D3, and Cyclin E are inferior prognostic factors for PCNSL. PMID: 23422111
CCND3 gene amplification is a marker of aggressiveness and might be a predictor of tumor progression in bladder urothelial carcinoma PMID: 23830405
Study reports that a cis-acting element, located between nucleotides 31 and 50 of the human CCND3 5' UTR, forms a stable G-quadruplex structure and represses translation of a reporter gene and the CCND3 gene in human cell lines. PMID: 22858673
Lycorine hydrochloride effectively inhibited mitotic proliferation of Hey1B cells through enhanced expression of the cell cycle inhibitor p21 and marked down-regulation of cyclin D3 expression. PMID: 23376478
No significant correlation was found between p-27, Cyclin D3, and cyclin E in pediatric Embryonal tumors PMID: 22763761
7 gains of CCND3 were seen amon 17 orbital adnexa MALT lymphomas. CCND3 might simply be a marker of 6p gains and not play a major role in the pathogenesis of MALT lymphomas. PMID: 23240690
cyclin D3 is reduced in myotonic dystrophy due to increased phosphorylation at T283 by GSK3beta, which triggers the degradation of cyclin D3. PMID: 23160194
CCND3 protein expression was observed to be negatively correlated with miR-138 expression in HCC tissues. PMID: 22362728
The overexpression of ETS1 could suppress cyclin D3 mRNA and protein levels. PMID: 21841808
Lymph node sections from 138 HL patients were immunohistochemically stained for cyclin D3 (CCND3), MCM2 and MCM7 aiming to investigate clinical outcome. PMID: 21965782
These results suggest that alpha9-nAChR-mediated cyclin D3 overexpression is important for nicotine-induced transformation of normal human breast epithelial cells. PMID: 20229177
In addition to having a pivotal role in the up-regulation of IL-2 and IL-2RA gene expression, IKK controls the expression of cyclin D3, cyclin E and CDK2, and the stability SKP2 and its co-factor CKS1B, through mechanisms independent of IL-2. PMID: 20465575
Overexpressions of nuclear cyclin D3 is associated with non-small cell lung cancer. PMID: 20631637
study suggests that Cyclin D3 gene amplification might be a predictor of aggressiveness in BCG-treated bladder urothelial carcinoma in situ PMID: 20821231
Gene knockdown of cyclin D3 did not inhibit pRb phosphorylation on cdk4/6- and cdk2-specific residues or measurably affect viability and proliferation. PMID: 20107311
Ubiquitin/proteasome-dependent degradation of D-type cyclins is linked to tumor necrosis factor-induced cell cycle arrest. PMID: 11864973
High cyclin D3 expression had a significantly lower response to antineoplastic agents in diffuse large B-cell lymphomas PMID: 11895902
interaction with p58(PITSLRE) PMID: 12082095
A cofactor of retinoic acid receptors, modulating their activity in the presence of cellular retinoic acid-binding protein II. PMID: 12482873
cyclin D3 is activated by E2F1;the essential E2F regulatory element of the cyclin D3 promoter is between nucleotides -143 and -135 relative to the initiating methionine codon PMID: 12611887
overexpression of cyclin D3 was mutually exclusive with Rb/p16 aberrant expression status supporting an oncogenic role for cyclin D3 PMID: 12647795
High levels of this protein are gound in malignant glioma. PMID: 12778072
cyclin D3 protein is expressed in a fraction of human goiters but it is strongly overexpressed in most follicular adenomas PMID: 14576819
cyclin d3 does not have a role in regulating AML1/RUNX1 increase during G1 to S cell cycle progression PMID: 14747476
GSK-3beta has a role in cAMP-induced degradation of cyclin D3 PMID: 15252116
Increased expression of Cyclin D3 is associated with follicular lymphoma PMID: 15305377
cyclin D3 is degraded via proteasome and that Thr-283 is essential for its degradation PMID: 15326477
cyclin D3 specifically interacted with eIF3k through its C-terminal domain; eIF3k distributed both in nucleus and cytoplasm and colocalized with cyclin D3 PMID: 15327989
activating transcription factor 5 (ATF5) is a new interacting partner of cyclin D3 PMID: 15358120
silencing cyclin D3 by RNA interference inhibits S phase entry and sensitizes breast cancer cells to TRAIL, indicating a key role for cyclin D3 repression in these events PMID: 15569667
cyclin D3 may have a role in progression of laryngeal squamous cell carcinoma PMID: 15671552
Cyclin D3 up-regulated transcriptional activity of VDR and this effect was counteracted by overexpression of CDK4 and CDK6 PMID: 16105657

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.