Recombinant Human Fractalkine (CX3CL1) Protein (His-SUMO)
Beta LifeScience
SKU/CAT #: BLC-09983P

Greater than 90% as determined by SDS-PAGE.
Recombinant Human Fractalkine (CX3CL1) Protein (His-SUMO)
Beta LifeScience
SKU/CAT #: BLC-09983P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Human Fractalkine (CX3CL1) Protein (His-SUMO) is produced by our E.coli expression system. This is a protein fragment. |
Purity | Greater than 90% as determined by SDS-PAGE. |
Uniprotkb | P78423 |
Target Symbol | CX3CL1 |
Synonyms | A 152E5.2; AB030188; ABCD 3; ABCD3; AI848747; C-X3-C motif chemokine 1; C3Xkine; Chemokine (C-X3-C motif) ligand 1; Chemokine C X3 C motif ligand 1; Chemokine CX3C Motif Ligand 1; CX3C membrane anchored chemokine; CX3C membrane-anchored chemokine; Cx3cl1; CXC 3; CXC3; CXC3C; D8Bwg0439e; FKN; Fractalkine; Neurotactin; NTN; NTT; Processed fractalkine; SCYD 1; SCYD1; Small inducible cytokine D1; Small inducible cytokine subfamily D (Cys X3 Cys) member 1; small inducible cytokine subfamily D (Cys-X3-Cys), member 1 (fractalkine, neurotactin); Small inducible cytokine subfamily D member 1; Small-inducible cytokine D1; X3CL1_HUMAN |
Species | Homo sapiens (Human) |
Expression System | E.coli |
Tag | N-6His-SUMO |
Target Protein Sequence | QHHGVTKCNITCSKMTSKIPVALLIHYQQNQASCGKRAIILETRQHRLFCADPKEQWVKDAMQHLDRQAAALTRNG |
Expression Range | 25-100aa |
Protein Length | Partial |
Mol. Weight | 24.6kDa |
Research Area | Cell Adhesion |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | Chemokine that acts as a ligand for both CX3CR1 and integrins ITGAV:ITGB3 and ITGA4:ITGB1. The CX3CR1-CX3CL1 signaling exerts distinct functions in different tissue compartments, such as immune response, inflammation, cell adhesion and chemotaxis. Regulates leukocyte adhesion and migration processes at the endothelium. Can activate integrins in both a CX3CR1-dependent and CX3CR1-independent manner. In the presence of CX3CR1, activates integrins by binding to the classical ligand-binding site (site 1) in integrins. In the absence of CX3CR1, binds to a second site (site 2) in integrins which is distinct from site 1 and enhances the binding of other integrin ligands to site 1.; The soluble form is chemotactic for T-cells and monocytes, but not for neutrophils.; The membrane-bound form promotes adhesion of those leukocytes to endothelial cells. |
Subcellular Location | Cell membrane; Single-pass type I membrane protein.; [Processed fractalkine]: Secreted. |
Protein Families | Intercrine delta family |
Database References | HGNC: 10647 OMIM: 601880 KEGG: hsa:6376 STRING: 9606.ENSP00000006053 UniGene: PMID: 28677664 |