Recombinant Human Forkhead Box Protein P1 (FOXP1) Protein (GST)

Name: Recombinant Human Forkhead Box Protein P1 (FOXP1) Protein (GST)
Brand: Beta LifeScience
SKU: BLC-10262P
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Collections: High-quality recombinant proteins, Other recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human Forkhead Box Protein P1 (FOXP1) Protein (GST) is produced by our E.coli expression system. This is a protein fragment.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	Q9H334
Target Symbol	FOXP1
Synonyms	12CC4; FLJ23741; Fork head related protein like B; Forkhead box P1; Forkhead box protein P1; FOX P1; FOXP 1; foxp1; FOXP1_HUMAN; Glutamine rich factor 1; hFKH1B; HSPC215; MGC12942; MGC88572; MGC99551; QRF 1; QRF1
Species	Homo sapiens (Human)
Expression System	E.coli
Tag	N-GST
Target Protein Sequence	MMQESGTETKSNGSAIQNGSGGSNHLLECGGLREGRSNGETPAVDIGAADLAHAQQQQQQALQVARQLLLQQQQQQQVSGLKSPKRNDKQPALQVPVSVAMMTPQVITPQQMQQ
Expression Range	1-114aa
Protein Length	Partial
Mol. Weight	39.2kDa
Research Area	Transcription
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Transcriptional repressor. Can act with CTBP1 to synergistically repress transcription but CTPBP1 is not essential. Plays an important role in the specification and differentiation of lung epithelium. Acts cooperatively with FOXP4 to regulate lung secretory epithelial cell fate and regeneration by restricting the goblet cell lineage program; the function may involve regulation of AGR2. Essential transcriptional regulator of B-cell development. Involved in regulation of cardiac muscle cell proliferation. Involved in the columnar organization of spinal motor neurons. Promotes the formation of the lateral motor neuron column (LMC) and the preganglionic motor column (PGC) and is required for respective appropriate motor axon projections. The segment-appropriate generation of spinal chord motor columns requires cooperation with other Hox proteins. Can regulate PITX3 promoter activity; may promote midbrain identity in embryonic stem cell-derived dopamine neurons by regulating PITX3. Negatively regulates the differentiation of T follicular helper cells T(FH)s. Involved in maintenance of hair follicle stem cell quiescence; the function probably involves regulation of FGF18. Represses transcription of various pro-apoptotic genes and cooperates with NF-kappa B-signaling in promoting B-cell expansion by inhibition of caspase-dependent apoptosis. Binds to CSF1R promoter elements and is involved in regulation of monocyte differentiation and macrophage functions; repression of CSF1R in monocytes seems to involve NCOR2 as corepressor. Involved in endothelial cell proliferation, tube formation and migration indicative for a role in angiogenesis; the role in neovascularization seems to implicate suppression of SEMA5B. Can negatively regulate androgen receptor signaling. Acts as a transcriptional activator of the FBXL7 promoter; this activity is regulated by AURKA.; Involved in transcriptional regulation in embryonic stem cells (ESCs). Stimulates expression of transcription factors that are required for pluripotency and decreases expression of differentiation-associated genes. Has distinct DNA-binding specifities as compared to the canonical form and preferentially binds DNA with the sequence 5'-CGATACAA-3' (or closely related sequences). Promotes ESC self-renewal and pluripotency.
Subcellular Location	Nucleus.
Database References	HGNC: 3823 OMIM: 605515 KEGG: hsa:27086 STRING: 9606.ENSP00000318902 UniGene: PMID: 30181650 miR-29b recedes the progression of multiple myeloma (MM) via downregulating FOXP1, which may provide a potential biological target for MM treatment. PMID: 30068241 The tumour suppressors FOXP1 and NKX3.1, strongly implicated in PCa development, were identified as key transcription factors regulating TPbeta expression through Prm3 in both PCa cell lines. PMID: 28890397 The findings, in addition to expanding the molecular spectrum of FOXP1 mutations, emphasize the emerging role of WGS in identifying small balanced chromosomal rearrangements responsible for neurodevelopmental disorders and not detected by conventional cytogenetics. PMID: 29969624 MiR-92a may act as a tumor inducer in OSCC by suppressing FOXP1 expression. PMID: 29772443 the varients of FOXP1 and FOXF1 genes are functionally associated with oesophageal adenocarcinoma in Chinese population. PMID: 29666340 Results show that FOXP1 acts as the functional protein of SNHG12. Its expression is regulated by SNHG12 and miR-101-3p in glioma cells. PMID: 30098431 Having a SNP in the FOXP1 gene in the absence of Reflux symptoms had an odds ratio of developing Barrett's esophagus of 1.5. PMID: 29713984 FOXP1 expression is epigenetically regulated by PRMT5. PMID: 29262329 we have identified a novel de novo missense variant in FOXP1 that is identical to the most well-studied etiological variant in FOXP2. Functional characterization revealed clear similarities between these equivalent mutations in terms of their impact on protein function. PMID: 28741757 FOXP1-related intellectual disability syndrome (ID) is a recognisable entity with wide clinical spectrum and frequent systemic involvement; more ID and neuromotor delay, sensorineural hearing loss and feeding difficulties are more common in patients with interstitial 3p deletions versus patients with monogenic FOXP1 defects; Mutations result in impaired transcriptional repression and/or reduced protein stability PMID: 28735298 Prognostic value of decreased FOXP1 protein expression in various tumors, is reported. PMID: 27457567 Blimp1, Foxp1 and pStat3 are expressed in extranodal diffuse large B-cell lymphomas PMID: 27924626 Two rare novel FOXP1 variants associated with a phenotype similar to Mental Retardation with Language Impairment and with or without Autistic Features (MIM 613670). PMID: 28884888 High FOXP1 expression is associated with acute lymphoblastic leukemia. PMID: 27588474 The majority of pathogenic missense and in-frame mutations lie in the DNA-binding domain. The mutations perturb amino acids necessary for binding to the DNA or interfere with the domain swapping that mediates FOXP1 dimerization. PMID: 29090079 Increased frequency of FOXP2 expression significantly correlated with FOXP1-positivity, and FOXP1 co-immunoprecipitated FOXP2 from activated B-cell-diffuse large B-cell lymphoma (ABC-DLBCL) cells. PMID: 27224915 EBV-miR-BART11 plays a crucial role in the promotion of inflammation-induced nasopharyngeal carcinoma (NPC) and gastric cancer (GC) carcinogenesis by directly targeting and inhibiting FOXP1 tumor-suppressive effects. PMID: 27167345 Although the mutant huntingtin gene is expressed widely, neurons of the striatum and cortex are selectively affected in Huntington's disease (HD). Our results suggest that this selectivity is attributable to the reduced expression of Foxp1, a protein expressed selectively in striatal and cortical neurons that plays a neuroprotective role in these cells. PMID: 28550168 the activity of multiple alternate FOXP1 promoters to produce multiple protein isoforms is likely to regulate B-cell maturation. PMID: 27056922 these novel insights into the function of FOXP1 isoforms in controlling the transcriptional program, survival and differentiation of B cells advance our understanding of the role of FOXP1 in lymphomagenesis and further enhance the value of FOXP1 for diagnostics, prognostics, and treatment of DLBCL patients. PMID: 27909217 Data indicate that forkhead box P1 protein (FOXP1) as a target of microRNA miR-92a in primary mediastinal large B-cell lymphoma (PMBL). PMID: 27806315 Results suggest that domain swapping in FoxP1 is at least partially linked to monomer folding stability and follows an unusual three-state folding mechanism, which might proceed via transient structural changes rather than requiring complete protein unfolding as do most domain-swapping proteins PMID: 27276253 these data identify FOXP1 as an essential transcriptional regulator for primary human CD4(+) T cells and suggest its potential important role in the development of PTCL. PMID: 27861791 Kaplan-Meier survival analysis showed that pancreatic ductal adenocarcinoma patients with negative forkhead box P1 and forkhead box O3a expression survived significantly shorter than patients with positive forkhead box P1 and forkhead box O3a expression (p = 0.000). PMID: 28466777 FOXP1 knockdown significantly suppressed growth of HCC cells and induced G1/S phase arrest. PMID: 27618020 FOXP1 has protein-protein interaction with NFAT1 on DNA and enhances breast cancer cell migration by repressing NFAT1 transcriptional activity. PMID: 27859969 FOXP1 functions as an oncogene in promoting cancer stem cell-like characteristics in ovarian cancer cells. PMID: 26654944 The findings highlight that de novo FOXP1 variants are a cause of sporadic intellectual disability and emphasize the importance of this transcription factor in neurodevelopment. PMID: 26647308 we provide supportive evidence that genetic variants at FOXP1, BARX1, and FOXF1 confer risk for the development of EAC. PMID: 26383589 Cell-line derived FOXP1 target genes that were highly correlated with FOXP1 expression in primary DLBCL accurately segregated the corresponding clinical subtypes of a large cohort of primary DLBCL isolates PMID: 26787899 S1PR2 is repressed by FOXP1 in activated B-cell and germinal center B-cell DLBCL cell lines with aberrantly high FOXP1 levels; S1PR2 expression is further inversely correlated with FOXP1 expression in 3 DLBCL patient cohorts. PMID: 26729899 FOXP1 represents a novel regulator of genes targeted by the class II MHC transactivator CIITA and CD74. PMID: 26500140 FOXP1 - novel candidate genes validated in a large case-control sample of schizophrenia. PMID: 26460480 Studied the expression of FOXP1 in colorectal cancer and its potential associations with outcome in colorectal cancer. PMID: 26489674 Authors identified forkhead box protein P1 (FOXP1) as a direct target of miR-504 using microarray analysis and a luciferase assay. PMID: 26854715 FOXP1 is present in normal cells of erythroid and myeloid linages and may have a possible role in development of all hematopoetic cells as well as possible involvement in neoplasm development of myeloid disorders. PMID: 26898077 Over-expression of FOXP1 and SPINK1 may participate in the carcinogenesis of hepatitis B virus related cirrhosis. PMID: 26054682 FOXP1 expression is closely related to the degree of malignancy of epithelial ovarian cancer and may be a reliable index of the chemoresistance and prognosis of ovarian cancer PMID: 25895457 FOXP1 overexpression specifically inhibits formation of IgG- but not IgM-secreting Plasma Cells. PMID: 26289642 integral role for FoxP1 in regulating signaling pathways vulnerable in autism and the specific regulation of striatal pathways important for vocal communication PMID: 26494785 This study demonstrated that Brain-specific Foxp1 deletion impairs neuronal development and causes autistic-like behavior and mental disorders. PMID: 25266127 Foxp1 mediates programming of limb-innervating motor neurons from mouse and human embryonic stem cells. PMID: 25868900 FOXP1 has a role in potentiating Wnt/beta-catenin signaling in diffuse large B cell lymphoma PMID: 25650440 Data indicate that the mRNA level for forkhead box P1 (FOXP1) and estrogen receptor beta (ERbeta) in ovarian carcinoma tissues decreased, while the expression level of estrogen receptor alpha (ERalpha) mRNA increased. PMID: 25500588 results suggest a novel mechanism in which AR-induced FOXP1 functions as a direct modulator of the AR and FOXA1 centric global transcriptional network. PMID: 25329375 Our results suggest that down-regulation of FOXP1 expression is a common event in high-risk neuroblastoma pathogenesis and may contribute to tumor progression and unfavorable patient outcome. PMID: 25406647 Abnormal expression of FOXP1 in renal cell carcinoma may create progression of tumor from low grade to high grade by regulating the HIF-1-VEGF pathway. PMID: 25778315 The significant expression of FOXP1 may be helpful to some extent in the pathologic diagnosis of cervical mucinous minimal deviation adenocarcinoma PMID: 24908370 Through direct repression of proapoptotic genes, (aberrant) expression of FOXP1 complements (constitutive) NF-kappaB activity to promote B-cell survival and can thereby contribute to B-cell homeostasis and lymphomagenesis. PMID: 25267198

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.