Recombinant Human Forkhead Box Protein M1 (FOXM1) Protein (His-SUMO&Myc)
Beta LifeScience
SKU/CAT #: BLC-02291P
Greater than 90% as determined by SDS-PAGE.
Recombinant Human Forkhead Box Protein M1 (FOXM1) Protein (His-SUMO&Myc)
Beta LifeScience
SKU/CAT #: BLC-02291P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Human Forkhead Box Protein M1 (FOXM1) Protein (His-SUMO&Myc) is produced by our E.coli expression system. This is a protein fragment. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Uniprotkb | Q08050 |
| Target Symbol | FOXM1 |
| Synonyms | FKHL16; Forkhead box M1; Forkhead box protein M1; forkhead like 16; Forkhead-related protein FKHL16; FOX M1; Foxm1; FOXM1_HUMAN; FOXM1B; Hepatocyte nuclear factor 3 forkhead homolog 11; HFH-11; HFH11; HNF-3/fork-head homolog 11; HNF3; INS1; M phase phosphoprotein 2; M-phase phosphoprotein 2; MPHOSPH2; MPM-2 reactive phosphoprotein 2; MPP2; PIG29; TGT3; Transcription factor Trident; Trident; WIN; Winged-helix factor from INS-1 cells; Winged-helix factor from INS1 cells |
| Species | Homo sapiens (Human) |
| Expression System | E.coli |
| Tag | N-10His-SUMO&C-Myc |
| Target Protein Sequence | ERPPYSYMAMIQFAINSTERKRMTLKDIYTWIEDHFPYFKHIAKPGWKNSIRHNLSLHDMFVRETSANGKVSFWTIHPSANRYLTLDQVFKPL |
| Expression Range | 235-327aa |
| Protein Length | Partial |
| Mol. Weight | 31.2kDa |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Transcriptional factor regulating the expression of cell cycle genes essential for DNA replication and mitosis. Plays a role in the control of cell proliferation. Plays also a role in DNA breaks repair participating in the DNA damage checkpoint response. |
| Subcellular Location | Nucleus. |
| Database References | HGNC: 3818 OMIM: 602341 KEGG: hsa:2305 STRING: 9606.ENSP00000342307 UniGene: PMID: 30365126 |
