Recombinant Human Follicle-Stimulating Hormone Receptor (FSHR) Protein (His)

Beta LifeScience SKU/CAT #: BLC-05146P
Greater than 85% as determined by SDS-PAGE.
Greater than 85% as determined by SDS-PAGE.

Recombinant Human Follicle-Stimulating Hormone Receptor (FSHR) Protein (His)

Beta LifeScience SKU/CAT #: BLC-05146P
Save $746
/
Size

Submit an inquiry or email sales for a custom bulk quote. Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description Recombinant Human Follicle-Stimulating Hormone Receptor (FSHR) Protein (His) is produced by our Baculovirus expression system. This is a protein fragment.
Purity Greater than 85% as determined by SDS-PAGE.
Uniprotkb P23945
Target Symbol FSHR
Synonyms Follicle stimulating hormone receptor; Follicle stimulating hormone receptor isoform 1; Follicle-stimulating hormone receptor; Follitropin receptor; FSH receptor; FSH-R; Fshr; FSHR_HUMAN; FSHRO; LGR1; MGC141667; MGC141668; ODG1; ovarian dysgenesis 1
Species Homo sapiens (Human)
Expression System Baculovirus
Tag N-6His
Target Protein Sequence CHHRICHCSNRVFLCQESKVTEIPSDLPRNAIELRFVLTKLRVIQKGAFSGFGDLEKIEISQNDVLEVIEADVFSNLPKLHEIRIEKANNLLYINPEAFQNLPNLQYLLISNTGIKHLPDVHKIHSLQKVLLDIQDNINIHTIERNSFVGLSFESVILWLNKNGIQEIHNCAFNGTQLDELNLSDNNNLEELPNDVFHGASGPVILDISRTRIHSLPSYGLENLKKLRARSTYNLKKLPTLEKLVALMEASLTYPSHCCAFANWRRQISELHPICNKSILRQEVDYMTQARGQRSSLAEDNESSYSRGFDMTYTEFDYDLCNEVVDVTCSPKPDAFNPCEDIMGYNILR
Expression Range 18-366aa
Protein Length Partial
Mol. Weight 41.0 kDa
Research Area Neuroscience
Form Liquid or Lyophilized powder
Buffer Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Storage 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function G protein-coupled receptor for follitropin, the follicle-stimulating hormone. Through cAMP production activates the downstream PI3K-AKT and ERK1/ERK2 signaling pathways.
Subcellular Location Cell membrane; Multi-pass membrane protein.
Protein Families G-protein coupled receptor 1 family, FSH/LSH/TSH subfamily
Database References

HGNC: 3969

OMIM: 136435

KEGG: hsa:2492

STRING: 9606.ENSP00000384708

UniGene: PMID: 29738186

  • Results indicate the frequency distribution of the common follicle stimulating hormone receptor (FSHR) single-nucleotide polymorphisms (SNPs) in Mexican subjects of Hispanic origin. PMID: 30340493
  • This study demonstrates that both gonadotrophin receptors9 FSH receptor (FSHR) and LH/choriogonadotrophin receptor (LHCGR) are expressed along the glandular epithelium of endometria and they mediate the effects of gonadotrophins on intracellular functions. PMID: 29974367
  • rs6165 and rs6166 genotypes associated with in vitro fertilization outcome PMID: 29916276
  • High FSHR expression is associated with polycystic ovary syndrome. PMID: 29626103
  • The paper reviews the data concerning the appearance of ectopic FSHR in particular human neoplasms. The possible involvement of FSHR in tumor progression and the use of FSHR for diagnostic/therapeutic purposes is also reviewed. PMID: 29952426
  • Data provide evidence that FSHR expression is regulated by BDNF which affects its expression and post-translational modifications in granulosa cells. PMID: 28282971
  • we observed that a genetic variant associated with FSHR activity may modulate the susceptibility to testicular germ cell cancer PMID: 29179257
  • The results herein suggest that the FSHR polymorphism N680S is significantly associated with preterm birth in a Mexican-Mestizo population. PMID: 28282771
  • FSHR single nucleotide polymorphism is associated with poor ovarian response in Egyptian women undergoing IVF procedure. PMID: 28825151
  • Findings suggest that 680Ser-Ser/GG genotype and "GG/307Ala680Ser" haplotype increase the risk of endometriosis in fertile women, while "GA/307Ala680Asn" haplotype decreases the risk of endometriosis development and progression. PMID: 29683332
  • The FSHR -29G/A polymorphism modulates FSH and, for the first time, LH serum levels and body mass index in normozoospermic men. PMID: 28624859
  • FSH-FSHR signaling was shown to promote HUVEC angiogenesis and thereafter suggested to have an influential role in pregnancy. PMID: 27848975
  • the novel homozygous FSHR variant observed in 2 siblings with Hypergonadotropic hypogonadism can expand the spectrum of FSHR mutations in humans. PMID: 28591755
  • Follicle-stimulating hormone receptor single nucleotide polymorphisms are not associated with male infertility. PMID: 28224403
  • the expression levels of placental FSHR mRNA and protein were significantly decreased in pregnancies complicated by preeclampsia. PMID: 28534997
  • Polymorphisms of the FSH receptor is associated with normal morphology and genetic maturation (metaphase II) oocytes in dependence of genotypic variation polymorphisms. PMID: 27994298
  • T cells redirected against FSHR(+) tumor cells with full-length FSH represent a promising therapeutic alternative against a broad range of ovarian malignancies, with negligible toxicity even in the presence of cognate targets in tumor-free ovaries PMID: 27435394
  • Findings of this study suggest a significant association between FSHR gene p. Thr307Ala or p. Asn680Ser coding sequence change and PCOS. The variant homozygote genotype results in a higher risk of PCOS. PMID: 28547204
  • The evaluation of sperm DNA fragmentation as a surrogate marker of sperm quality, and of the FSHR SNP rs6166 (p.N680S), might be useful to predict the response to FSH treatment in men with idiopathic infertility PMID: 27329968
  • Mouse chondrocytes and human articular cartilage express functional FSHR. Moreover, FSH can act on chondrocytes and cause genetic changes. PMID: 29133260
  • The mutation p.R59X in FSHR is causative for primary ovarian insufficiency by means of arresting folliculogenesis. PMID: 29157895
  • two mutations, V(221)G and T(449)N, in the extracellular domain and transmembrane helix 3, of FSHR, respectively, are reported. PMID: 27889471
  • The reduced fertilisation and pregnancy rate was associated with a lower LH receptor density and a lack of essential down-regulation of the FSH and LH receptor. PMID: 28188844
  • This work demonstrates that the expression of FSHR and LHCGR can be induced in hGL5 cells but that the FSHR-dependent cAMP/PKA pathway is constitutively silenced, possibly to protect cells from FSHR-cAMP-PKA-induced apoptosis. PMID: 27502035
  • The incidence of the Ser/Ser genotype was higher in patients with higher recombinant human follicle-stimulating hormone consumption. Based on our results, we hypothesize an association between the follicle-stimulating hormone receptor polymorphisms and a "hyporesponse" to exogenous follicle-stimulating hormone. PMID: 26902430
  • The data suggest novel follicle-stimulating hormone receptor expression in endometriotic lesions, qualitatively and quantitatively different from that of normal endometrium. PMID: 26704526
  • Novel mutations, c.419delA and c.1510C>T of the FSHR gene were associated with resistant ovarian syndrome. PMID: 28397217
  • Association of the FSHR G-29A, 919A > G, 2039A > G polymorphisms with male infertility in Han-Chinese PMID: 28764642
  • A polymorphism within the promoter of FSHR is determined to not be associated with ovarian reserve or response to controlled ovarian hyperstimulation. PMID: 27448492
  • Description of a novel functional FSHR expression, where FSH-stimulated CYP19A1 expression and estrogen production in recto-vaginal endometriotic nodules (RVEN) are demonstrated. This locally FSH-induced estrogen production may contribute to the pathology, development, progression, and severity of RVEN . PMID: 27224263
  • N680S FSHR gene polymorphism affects the efficacy of recombinant versus highly purified follicle-stimulating hormone. PMID: 26959715
  • The results of this study demonstrate that the genetic combination of A/G for polymorphism c.2039 with G/G for polymorphism c.-29 of the FSHR gene is significantly associated with the highest number of collected oocytes (p = 0.03). This association was significant even after controlling for the effect of other clinical variables PMID: 27817039
  • Data suggest that both sisters exhibiting primary ovarian failure are homozygous for a previously unreported missense mutation (c.1222G.T, p.Asp408Tyr) in the second transmembrane domain of FSHR; consanguinity in this Turkish family was reported. [CASE REPORT] PMID: 26911863
  • The luteinizing hormone/human chorionic gonadotrophin receptor (LHCGR) variant N312S and the follicle-stimulating hormone receptor (FSHR) variant N680S can be utilized for the prediction of pregnancy chances in women undergoing IVF. PMID: 26769719
  • The role of FSHR gene variants (SNPs in exon 10 (codon 307 and 680) and in the core promoter region (at position -29) and Ala189Val inactivating mutation) in Turkish infertile women PMID: 26404793
  • Ala307Thr polymorphism in FSHR can be potentially associated to primary ovarian insufficiency development and can be considered as a screening marker in patients with ovarian failure signals. PMID: 26291798
  • The Asn680Ser polymorphism within the FSHR gene was not associated with endometriosis and infertility. PMID: 25935136
  • Our studies further confirmed reports that there were no significant associations between the FSHR Thr307Ala and Asn680Ser polymorphisms and male infertility risk. However, a combined FSHR genotype showed significant association with male infertility. PMID: 26125757
  • Endothelial FSHR expression in breast cancer is associated with vascular remodeling at tumor periphery. PMID: 25652007
  • The extracellular loop 2 (EL2) of FSH receptor (FSHR) plays a pivotal role in various events downstream of FSH stimulation. PMID: 25791375
  • the hinge region and its adjacent domains have roles in binding and signaling patterns of the thyrotropin and follitropin receptor PMID: 25340405
  • This study demonstrate that the two common FSHR polymorphisms FSHR 307 and FSHR 680 affect FSH-induced granulosa cell responses in human small antral follicles. PMID: 25403644
  • Girls homozygous for FSHR -29AA (reduced FSH receptor expression) entered puberty 7.4 (2.5-12.4) months later than carriers of the common variants FSHR -29GG+GA. PMID: 25231187
  • This is the first study to confirm the association of novel LHCGR and FSHR SNPs with PCOS. The differential association of LHCGR and FSHR variants with PCOS confirms the racial/ethnic contribution to their association with PCOS. PMID: 25649397
  • Follicle-stimulating hormone receptor gene polymorphism at position 680 is associated with different ovarian responses to controlled ovarian hyperstimulation PMID: 25132286
  • the present study suggested that the FSHR polymorphisms were not associated with an increased risk of polycystic ovary syndrome PMID: 25218548
  • The distributions of FSHR polymorphisms may not have an effect on endometriosis development but they are associated with the severity of the disease. PMID: 25502184
  • The role of the N680S FSHR polymorphism in ovarian response to ovarian stimulation. [Meta-analysis] PMID: 25526787
  • A novel pathogenic variant in FSHR (c.1253T>G, p.Ile418Ser), inherited as an autosomal recessive trait from heterozygous parents responsible for premature ovarian failure. PMID: 25875778

    • FAQs

    Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

    Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

    Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

    Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

    Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

    Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

    To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.

    More from All Products
    Tn5 Transposase
    • Expression system: E.coli;
    CAT#: TN5-BL01
    Sale
    SDS-PAGE analysis of Human SHFL (Shiftless Antiviral Inhibitor Of Ribosomal Frameshifting Protein) - Recombinant Protein, CAT# BLT-08873P showing >85% purity under 15% SDS-PAGE (Reduced)
    Human SHFL (Shiftless Antiviral Inhibitor Of Ribosomal Frameshifting Protein) - Recombinant Protein
    • Molecule: SHFL;
    • Species: Human;
    • Expression system: E.coli;
    • Tag: N-6His+sumo;
    • Sequence: 1-291;
    CAT#: BLT-08873P

    Save $50
    Sale
    SDS-PAGE analysis of Human NDUFV1 (Nadh Dehydrogenase [Ubiquinone] Flavoprotein 1, Mitochondrial) - Recombinant Protein, CAT# BLT-08321P, showing >90% purity under 15% SDS-PAGE (Reduced)
    Human NDUFV1 (Nadh Dehydrogenase [Ubiquinone] Flavoprotein 1, Mitochondrial) - Recombinant Protein
    • Molecule: NDUFV1;
    • Species: Human;
    • Expression system: E.coli;
    • Tag: N-6His+SUMO;
    • Sequence: 21-464aa;
    CAT#: BLT-08321P

    Save $50
    Sale
    SDS-PAGE analysis of Human NEU2 (Sialidase-2) - Recombinant Protein, CAT# BLT-08142P, showing >90% purity under 15% SDS-PAGE (Reduced)
    Human NEU2 (Sialidase-2) - Recombinant Protein
    • Molecule: NEU2;
    • Species: Human;
    • Expression system: E.coli;
    • Tag: N-6His;
    • Sequence: 1-380aa;
    CAT#: BLT-08142P

    Save $50
    Sale
    SDS-PAGE analysis of Mouse Cebpb (Ccaat/Enhancer-Binding Protein Beta) - Recombinant Protein, CAT# BLT-08014P, showing >90% purity under 15% SDS-PAGE (Reduced)
    Mouse Cebpb (Ccaat/Enhancer-Binding Protein Beta) - Recombinant Protein
    • Molecule: CEBPB;
    • Species: Mouse;
    • Expression system: E.coli;
    • Tag: N-His-GST;
    • Sequence: 1-296aa;
    CAT#: BLT-08014P

    Save $50
    Sale
    SDS-PAGE analysis of Human BAX (Apoptosis Regulator Bax) - Recombinant Protein, CAT# BLT-07419P, showing >90% purity under 15% SDS-PAGE (Reduced)
    Human BAX (Apoptosis Regulator Bax) - Recombinant Protein
    • Molecule: BAX;
    • Species: Human;
    • Expression system: E.coli;
    • Tag: N-6His;
    • Sequence: 1-171aa;
    CAT#: BLT-07419P

    Save $50
    Recently viewed