Recombinant Human Flotillin-2 (FLOT2) Protein (His&Myc)

Name: Recombinant Human Flotillin-2 (FLOT2) Protein (His&Myc)
Brand: Beta LifeScience
SKU: BLC-06246P
Availability: InStock

Greater than 85% as determined by SDS-PAGE.

Collections: High-quality recombinant proteins, Other recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human Flotillin-2 (FLOT2) Protein (His&Myc) is produced by our E.coli expression system. This is a full length protein.
Purity	Greater than 85% as determined by SDS-PAGE.
Activity	Not tested.
Uniprotkb	Q14254
Target Symbol	FLOT2
Synonyms	Epidermal surface antigen;ESA;Membrane component chromosome 17 surface marker 1
Species	Homo sapiens (Human)
Expression System	E.coli
Tag	N-10His&C-Myc
Target Protein Sequence	GNCHTVGPNEALVVSGGCCGSDYKQYVFGGWAWAWWCISDTQRISLEIMTLQPRCEDVETAEGVALTVTGVAQVKIMTEKELLAVACEQFLGKNVQDIKNVVLQTLEGHLRSILGTLTVEQIYQDRDQFAKLVREVAAPDVGRMGIEILSFTIKDVYDKVDYLSSLGKTQTAVVQRDADIGVAEAERDAGIREAECKKEMLDVKFMADTKIADSKRAFELQKSAFSEEVNIKTAEAQLAYELQGAREQQKIRQEEIEIEVVQRKKQIAVEAQEILRTDKELIATVRRPAEAEAHRIQQIAEGEKVKQVLLAQAEAEKIRKIGEAEAAVIEAMGKAEAERMKLKAEAYQKYGDAAKMALVLEALPQIAAKIAAPLTKVDEIVVLSGDNSKVTSEVNRLLAELPASVHALTGVDLSKIPLIKKATGVQV
Expression Range	2-428aa
Protein Length	Full Length of Mature Protein
Mol. Weight	54.4 kDa
Research Area	Neuroscience
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	May act as a scaffolding protein within caveolar membranes, functionally participating in formation of caveolae or caveolae-like vesicles. May be involved in epidermal cell adhesion and epidermal structure and function.
Subcellular Location	Cell membrane; Peripheral membrane protein. Membrane, caveola; Peripheral membrane protein. Endosome. Membrane; Lipid-anchor. Note=Membrane-associated protein of caveolae.
Protein Families	Band 7/mec-2 family, Flotillin subfamily
Database References	HGNC: 3758 OMIM: 131560 KEGG: hsa:2319 STRING: 9606.ENSP00000378368 UniGene: PMID: 28503944 Results provide evidence that Flot2 plays an important role in the progression of nasopharyngeal carcinoma cells, which may be partially related to its interaction with PLCD3. PMID: 29115528 Flot-2 protein expression was significantly elevated in cancerous tissues and Flot-2 played pivotal roles in the development and progression of cancers. Increased expression of Flot-2 was correlated to a poor prognosis in cancer patients. Review. PMID: 27981826 Data indicate miR-802 as a tumor suppressor in prostate cancer (PCa) progression and elucidated a novel mechanism of the miR-802/Flotillin-2 (Flot2) axis in the regulation of epithelial-mesenchymal transition (EMT), which may be a potential therapeutic target. PMID: 28188157 We demonstrated that LXR stimulation decreases mRNA and protein expression of FLOT2 and DHHC5 in MCF-7 cells. LXR stimulation also reduces Akt phosphorylation and its localization at the plasma membrane PMID: 28739689 Ectopic Flot2 could significantly reverse miR-485-mediated inhibition of metastasis and EMT, demonstrating Flot2 downregulation is involved in function of miR-485 PMID: 27262438 Western blot experiments designed to detect flotillin 2, TMEM256, Rab3B and LAMTOR1 showed that the level of these proteins was higher in urinary exosomes from prostate cancer patients compared to healthy males, and ELISA-based detection of flotillin 2 and PARK7 showed that the combination of these proteins was able to distinguish prostate cancer patients and healthy controls with 68% sensitivity and 93% specificity PMID: 27664330 This study presents the endocytic pathways of internalization for muscarinic type 3 receptor and flotillin-1/2 in salivary gland epithelial cells. knockdown of flot-1 or -2 by flotillin-specific siRNA prevented internalization and reduced the endocytic efficiency of muscarinic type 3 receptor. PMID: 27221048 There was a strong association between polymorphisms of flotillin-2 gene and CAD in the Chinese Han population PMID: 26556629 Flot-2 exerts a pro-neoplastic role in NPC and is involved in tumor progression and metastasis. Moreover, Flot-2 exerts its role through NF-kappaB and PI3K/Akt3 signaling. PMID: 26206082 Positive expression of Flot-2 protein may be an independent biomarker for poor prognosis in oral squamous cell carcinoma. PMID: 26339392 Flot2 is an indispensable member for TGF-beta signaling, which is essential for the epithelial-mesenchymal transition process in nasopharyngeal carcinoma metastasis PMID: 25909165 increased expression of Flot-2 and EGFR in non-small cell lung cancer patients is inversely proportional to the disease prognosis. PMID: 26161893 that miR-449a suppressed Flot2 expression results in decreased cell invasion through repressing TGF-beta-mediated-epithelial-mesenchymal transition PMID: 26576674 Knockdown of FLOT2 decreases breast cancer cell proliferation. Silencing of FLOT2 enhanced the transcriptional activity of FOXO factors by decreasing its phosphorylation through inhibiting the PI3K/Akt signaling pathway. PMID: 25738752 Our findings provided that high FLOT2 expression was associated with poor outcomes in non-small cell lung cancer patients PMID: 25755751 FLOT2 may serve as an oncogene in the development of cervical cancer PMID: 25755754 Flotillin 2 (FLOT2) is a direct target of microRNA-34a and the miR-34a/FLOT2 pathway plays a key role in melanoma proliferation and metastasis. PMID: 25403318 Flotillin-2 is plays a role in the initial steps of skeletal myogenesis. PMID: 25105415 results suggest that the increased expression of Flot-2 protein is a novel higher sensitivity biomarker that can predict lymph node metastases in NPC. PMID: 25014228 Our data suggest that FLOT2 is a novel molecule involved in renal cell carcinoma progression PMID: 25053596 Study suggests the Flot2 protein expression is correlated with cancer progression and poor prognosis in gastric carcinomas, probably due to its role in the regulation of cell proliferation, migration, and invasion in gastric carcinoma cells. PMID: 24854103 The FLOT2 is abundantly expressed in term villous placental CTs and endothelial cells, and in comparison, expression of these proteins in the ST is reduced. PMID: 23064789 Depletion of either flotillin-1 or flotillin-2 resulted in downregulation of ErbB3 and a selective reduction of ErbB2-ErbB3 receptor complexes. PMID: 24747692 Flotillins directly interact with gamma-catenin and regulate epithelial cell-cell adhesion. PMID: 24391950 High FLOT2 protein expression was associated with poor outcomes in patients with breast cancer. PMID: 23945257 We have identified flotillin 1 and 2 as new partners of the cadherin complexes PMID: 24046456 Results identify reggie-1 as a regulator of the Rab11a/SNX4-controlled sorting and recycling pathway. PMID: 23825023 By virtue of its abundant expression in enterocytes, flotillin-2 must have an essential function in intestinal physiology, especially in the colon. PMID: 23983584 Flot2 is an important regulator of mammary tumor-derived lung metastasis PMID: 23146906 a positive correlation exists between flotillin2 and erbB2 expression levels PMID: 23658725 Report role for flotillin 1/2 in interactions of lung epithelial cells with silica nanoparticles. PMID: 22669515 we describe how flotillin-1 and -2 contribute to the stabilization of ErbB2 at the cell surface in breast cancer tissue PMID: 22869152 results support predominant formation of flotillin-1 and -2 hetero-oligomers in resting and chemokine-stimulated human T-cells which may importantly contribute to structuring of the uropod. PMID: 23012365 by promoting EGFR internalization, reggie-1 restricts EGFR signaling involved in E-cadherin macropinocytosis and recycling and regulate adherens junction formation PMID: 22438585 potentially relevant protein substrates of DHHC5 PMID: 22081607 Reggie-1 (flotillin-2) dynamically colocalizes with KIF9 in living cells PMID: 21119006 flotillins have a role in NPC1L1-mediated cholesterol uptake and NPC1L1-flotillins-postive cholesterol-enriched membrane microdomains are involved in the mechanism for efficient cholesterol absorption PMID: 21187433 Studies indicate that spatial link between PrP and the microdomain-forming protein flotillins may contribute to PrP signaling, leading to thelocal assembly of membrane protein complexes at sites involved in cellular communication. PMID: 20515742 In hematopoietic cells, flotillins provide intrinsic cues that govern segregation of certain microdomain-associated molecules during immune cell polarization. PMID: 20027317 Flot-2 overexpression is associated with melanoma progression, with increased PAR-1 expression, and with transformation of SB2 melanoma cells to a highly metastatic line. PMID: 15492257 flotillin-2 identified and immunolocalized in the caveola-vesicle complexes (CVC )present in erythrocytes infected with P. vivax PMID: 16521037 flotillin-2 has a role in lymph node metastasis in melanoma PMID: 17013097 The results showed that flotillin-1 can interact with arginase1, and hence arginase activity was up-regulated by 26.8%. PMID: 17113085 These lines of evidence suggested that a Gq-coupled receptor activates specifically p38 MAPK through lipid rafts and Src kinase activation, in which flotillins positively modulate the Gq signaling. PMID: 17307333 Coassembly of flotillin1 and flotillin2 into microdomains induces membrane curvature, the formation of plasma-membrane invaginations morphologically similar to caveolae, and the accumulation of intracellular vesicles. PMID: 17600709 Reggie-1/flotillin-2 microdomains form independent of actin PMID: 17854803 deletion mutants of reggie-1/flotillin-2 accumulate in the Golgi complex in HeLa and Jurkat cells, suggesting Golgi-dependent trafficking of reggie-1/flotillin-2 PMID: 18237819 Flotillin 2 is a direct transcriptional target of the p53 family member genes in human cancer cells. PMID: 18296650 The interaction of flotillin-2 with amyloid precursor protein (APP) promotes the clustering of APP at the cell surface. PMID: 18337418

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.