Recombinant Human Ficolin-2 (FCN2) Protein (His)

Name: Recombinant Human Ficolin-2 (FCN2) Protein (His)
Brand: Beta LifeScience
SKU: BLC-11165P
Availability: InStock

Greater than 85% as determined by SDS-PAGE.

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Product Overview

Description	Recombinant Human Ficolin-2 (FCN2) Protein (His) is produced by our E.coli expression system. This is a full length protein.
Purity	Greater than 85% as determined by SDS-PAGE.
Uniprotkb	Q15485
Target Symbol	FCN2
Synonyms	37 kDa elastin-binding protein; Collagen/fibrinogen domain containing protein 2; Collagen/fibrinogen domain-containing protein 2; EBP 37; EBP-37; EBP37; FCN 2; Fcn2; FCN2_HUMAN; FCNL; Ficolin (collagen/fibrinogen domain containing lectin) 2 (hucolin); Ficolin B; Ficolin beta; Ficolin-2; Ficolin-B; Ficolin-beta; Ficolin2 ; Hucolin; L ficolin; L-ficolin; OTTHUMP00000022518; P35; RP11 263F14.2; Serum lectin p35
Species	Homo sapiens (Human)
Expression System	E.coli
Tag	N-6His
Target Protein Sequence	LQAADTCPEVKMVGLEGSDKLTILRGCPGLPGAPGPKGEAGTNGKRGERGPPGPPGKAGPPGPNGAPGEPQPCLTGPRTCKDLLDRGHFLSGWHTIYLPDCRPLTVLCDMDTDGGGWTVFQRRVDGSVDFYRDWATYKQGFGSRLGEFWLGNDNIHALTAQGTSELRVDLVDFEDNYQFAKYRSFKVADEAEKYNLVLGAFVEGSAGDSLTFHNNQSFSTKDQDNDLNTGNCAVMFQGAWWYKNCHVSNLNGRYLRGTHGSFANGINWKSGKGYNYSYKVSEMKVRPA
Expression Range	26-313aa
Protein Length	Full Length of Mature Protein
Mol. Weight	35.4 kDa
Research Area	Cardiovascular
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	May function in innate immunity through activation of the lectin complement pathway. Calcium-dependent and GlcNAc-binding lectin. Enhances phagocytosis of S.typhimurium by neutrophils, suggesting an opsonic effect via the collagen region.
Subcellular Location	Secreted.
Protein Families	Ficolin lectin family
Database References	HGNC: 3624 OMIM: 601624 KEGG: hsa:2220 STRING: 9606.ENSP00000291744 UniGene: Hs.54517
Tissue Specificity	Expressed by the liver and secreted in plasma.

Gene Functions References

this study shows that ficolin-2 gene rs7851696 polymorphism is associated with delayed graft function and acute rejection in klidney allograft recipients PMID: 28536887
the minority (C) allele at -64 of the FCN2 gene was less frequent among juvenile idiopathic arthritis patients than among control subjects PMID: 28405017
This is the first study evaluating the FCN2 gene polymorphisms in patients with rheumatic fever and rheumatic carditis finding a protective effect of -986 GG and -4 GG genotypes in the development of rheumatic fever and the -4 AG genotype for the development of carditis. PMID: 28576308
this study did not find any association of FCN2 (encoding ficolin-2 protein) promoter polymorphisms at positions -986, -602, and -4 with dental caries in Polish children. PMID: 28088794
Serum ficolin-2 concentrations in multiple tumor patients are significantly lower than those in healthy donors. PMID: 28844702
this study shows that Ficolin-2 plasma level is associated with short- and long-term mortality in patients with necrotizing soft tissue infection in Denmark PMID: 27355483
The results suggest that the Arctic populations of East Siberia are characterised by specificity of genetic make-up responsible for the activity of L-ficolin. PMID: 28391359
study provides evidence for an important role for the lectin pathway in the inflammatory response induced by cholesterol crystals (CC) and emphasize the role of ficolin-2 and MBL in the CC-mediated inflammation occurring during atherosclerotic plaque development PMID: 27183610
FCN2 inhibits epithelial-mesenchymal transition-induced metastasis of hepatocellular carcinoma via TGF-beta1/Smad signaling. PMID: 27177473
this study shows that FCN2 polymorphisms is not a major risk factor for community-acquired pneumonia in general, but that the +6424G>T SNP in the FCN2 gene predisposes to Coxiella burnetii pneumonia PMID: 28032346
subjects that were heterozygote carriers of both FCN2 + 6424 and FCN3 + 1637delC were sufficient mannan-binding lectin producers PMID: 26795763
systemic lupus erythematosus patients with low plasma ficolin-2 levels had an increased risk of having lupus nephritis PMID: 27981461
Ficolin-2 protein could bind with HIV-1 envelope glycoprotein gp120, and subsequently induce complement dependent cytotoxicity. PMID: 27576476
The FCN2 c.772G>T genotype appears to be associated with predisposition to chronic adenotonsillitis in the pediatric age group. PMID: 27368434
genotype not associated with acute cellular rejection after kidney transplantation, except for a trend toward a deleterious effect of rs7851696 PMID: 26924055
Serum levels of ficolin-2 and ficolin-3 were significantly lower in the cardiac syndrome X patients compared to controls. PMID: 27312152
association of FCN2 polymorphisms with nephritis and severe cumulative damage in SLE patients; no association with rheumatoid arthritis development PMID: 26464189
-557 A>G, -64 A>C and +6424 G>T SNPs of the FCN2 gene were correlated with pulmonary TB. PMID: 26379154
FCN2 and MBL2 allele frequencies were similarly distributed in early and late age-related macular degeneration cases compared with controls PMID: 26207622
this study provide novel insight in the binding and complement activating capacity of the lectin pathway initiation molecules ficolin-2 and ficolin-3 towards relevant Gram-negative pathogens of pathophysiological relevance. PMID: 26074063
Findings indicate the FCN2 variant +6359C>T is associated with the occurrence of visceral leishmaniasis and that ficolin-2 serum levels are elevated in Leishmania infections. PMID: 25965808
L-ficolin modulates the immune response to A. fumigatus. PMID: 25612732
Very low serum ficolin-2 levels were associated with higher risk of 30-day mortality in community-acquired pneumonia patients. PMID: 24736883
hepatitis c virus entry inhibitor PMID: 24854201
paper identifies phosphocholine moieties of pneumococcal teichoic acid as a novel L-ficolin ligand PMID: 25344472
There is lack of association of serum mannose-binding lectin or ficolins with complement activation in patients with antiphospholipid antibodies. PMID: 25083730
MBL deficiency or MBL2 and FCN2 mutations were not associated with an improved hepatitis B vaccine response in Kenyan HIV-1 uninfected individuals. PMID: 25024112
Ficolin-2 was depleted from plasma during cardiac surgery when using heparin-coated bypass circuits and did not reach baseline level 24 h postoperation. PMID: 25174443
CVID patients with bronchiectasis have very low levels of ficolin-2. The reason for the deficiency of ficolin-2 in CVID and any possible causal relationship is currently unknown. PMID: 25251245
binding of ficolin-2 to sulfated/phosphated carbohydrates PMID: 25447524
Ficolin-2 mediates serum protection by recognizing specific O-acetylated epitopes of pneumococcal capsule polysaccharides. PMID: 24683196
MBL2 and FCN2 genotypic variants were analyzed for association with the incidence of acute rejection within the first year after kidney transplantation. PMID: 24486561
Data suggest that the hepatitis C virus (HCV) entry inhibitor ficolin-2 is an antiviral innate immune molecule, whereas apolipoprotein E3 (ApoE3) blocks the effect of ficolin-2 and mediates an immune escape mechanism during chronic HCV infection. PMID: 24928988
bloodstream infections collected prospectively were associated with MBL2 and FCN2 genotypic variants over the first year after kidney transplantation PMID: 24182802
Ficolin-2 defends against virulent Mycobacteria tuberculosis infection in vivo, and its insufficiency is associated with infection in humans. PMID: 24040095
FCN2 polymorphisms for promoter regions -986, -602, -557, -64, -4 and exon 8 regions +6,359, +6,424 were determined in children with B-ALL. Medium/high-risk haplotype were associated with prolonged duration of febrile neutropenia and bacterial infections. PMID: 24453114
results show that SNPS in FCN2 are significantly more susceptible to infectious complications, SIRS and septic shock. PMID: 24227370
Data indicate that Ficolin-2 blood concentration dependents on sampling procedures. PMID: 23911396
Patients with chronic Chagas disease presented with decreased L-ficolin plasma levels that were associated with the 258S polymorphism. PMID: 23593180
this study reports for thefirst time the relationship between full FCN2 genotypes and serumprotein concentrations and discuss the relevance of these findings fordisease association studies PMID: 23619474
Data indicate that in contrast to serum level, the expression of Ficolin-2 (FCN2) was significantly lower in ovarian cancer (OC). PMID: 23744477
Variant FCN2 gene alleles of -64 and +6424 (in strong linkage disequlibrium) are known to be associated with low L-ficolin level or activity. PMID: 23525825
the expected positive association of complement genes with leprosy susceptibility and clinical outcomes in Han Chinese. PMID: 23423485
The association between L-ficolin and thrombocytopenia suggests a pathogenic role for L-ficolin in thrombocytopenia in systemic lupus erythematosus. PMID: 22350641
Our findings suggest that early increased ficolin-2 is highly correlated with hepatic inflammation and rapid viral response. PMID: 23298162
The genotype distribution of three functional SNP variants (-986 G > A, -602 G > A and -4A > G) of ficolin 2 differed significantly between the white, black, and Asian groups. The SNP variants were highly linked to each other. PMID: 22594803
Ficolin-2 Ala258Ser polymorphism in the donor independently predicts improved graft outcome. PMID: 22892990
These findings demonstrate that FCN2 promoter variants (-986G>A and -4A>G) influence ficolin-2 serum levels and susceptibility to schistosomiasis. PMID: 22693230
The purpose of this study was to determine whether circulating levels of ficolin-2 and ficolin-3 are altered in normal pregnancy and pre-eclampsia. PMID: 22670778
Cord blood MBL concentrations were significantly lower in intrauterine-growth-restriction (IUGR) cases than controls. No differences in H- and L-ficolin concentrations were observed between groups. PMID: 22082351

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.