Recombinant Human Fibronectin Type Iii Domain-Containing Protein 5 (FNDC5) Protein (His-SUMO)
Beta LifeScience
SKU/CAT #: BLC-04069P
Greater than 90% as determined by SDS-PAGE.
Recombinant Human Fibronectin Type Iii Domain-Containing Protein 5 (FNDC5) Protein (His-SUMO)
Beta LifeScience
SKU/CAT #: BLC-04069P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Human Fibronectin Type Iii Domain-Containing Protein 5 (FNDC5) Protein (His-SUMO) is produced by our E.coli expression system. This is a protein fragment. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Uniprotkb | Q8NAU1 |
| Target Symbol | FNDC5 |
| Synonyms | Fibronectin type III domain containing 5; Fibronectin type III domain-containing protein 5; Fibronectin type III repeat containing protein 2; Fibronectin type III repeat-containing protein 2; FNDC 5; Fndc5; FNDC5_HUMAN; FRCP2; irisin |
| Species | Homo sapiens (Human) |
| Expression System | E.coli |
| Tag | N-6His-SUMO |
| Target Protein Sequence | DSPSAPVNVTVRHLKANSAVVSWDVLEDEVVIGFAISQQKKDVRMLRFIQEVNTTTRSCALWDLEEDTEYIVHVQAISIQGQSPASEPVLFKTPREAEKMASKNKDEVTMKE |
| Expression Range | 32-143aa |
| Protein Length | Partial |
| Mol. Weight | 28.6kDa |
| Research Area | Cell Biology |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Contrary to mouse, may not be involved in the beneficial effects of muscular exercise, nor in the induction of browning of human white adipose tissue. |
| Subcellular Location | Cell membrane; Single-pass type I membrane protein. Peroxisome membrane; Single-pass type I membrane protein.; [Irisin]: Secreted. |
| Database References | HGNC: 20240 OMIM: 611906 KEGG: hsa:252995 STRING: 9606.ENSP00000362570 UniGene: PMID: 29673927 |
