Recombinant Human Fibronectin Type Iii Domain-Containing Protein 5 (FNDC5) Protein (His-SUMO)

Beta LifeScience SKU/CAT #: BLC-04069P
Greater than 90% as determined by SDS-PAGE.
Greater than 90% as determined by SDS-PAGE.

Recombinant Human Fibronectin Type Iii Domain-Containing Protein 5 (FNDC5) Protein (His-SUMO)

Beta LifeScience SKU/CAT #: BLC-04069P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description Recombinant Human Fibronectin Type Iii Domain-Containing Protein 5 (FNDC5) Protein (His-SUMO) is produced by our E.coli expression system. This is a protein fragment.
Purity Greater than 90% as determined by SDS-PAGE.
Uniprotkb Q8NAU1
Target Symbol FNDC5
Synonyms Fibronectin type III domain containing 5; Fibronectin type III domain-containing protein 5; Fibronectin type III repeat containing protein 2; Fibronectin type III repeat-containing protein 2; FNDC 5; Fndc5; FNDC5_HUMAN; FRCP2; irisin
Species Homo sapiens (Human)
Expression System E.coli
Tag N-6His-SUMO
Target Protein Sequence DSPSAPVNVTVRHLKANSAVVSWDVLEDEVVIGFAISQQKKDVRMLRFIQEVNTTTRSCALWDLEEDTEYIVHVQAISIQGQSPASEPVLFKTPREAEKMASKNKDEVTMKE
Expression Range 32-143aa
Protein Length Partial
Mol. Weight 28.6kDa
Research Area Cell Biology
Form Liquid or Lyophilized powder
Buffer Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function Contrary to mouse, may not be involved in the beneficial effects of muscular exercise, nor in the induction of browning of human white adipose tissue.
Subcellular Location Cell membrane; Single-pass type I membrane protein. Peroxisome membrane; Single-pass type I membrane protein.; [Irisin]: Secreted.
Database References

HGNC: 20240

OMIM: 611906

KEGG: hsa:252995

STRING: 9606.ENSP00000362570

UniGene: PMID: 29673927

  • There is a decrease in serum irisin level in type 2 diabetic patients with even more significant reduction in patients with diabetic nephropathy. PMID: 28875825
  • FNDC5 mRNA expression in skeletal muscle and circulating irisin concentration relatively to exercise mode, intensity, frequency and duration and the characteristics of the sample used PMID: 29127759
  • Serum concentrations of irisin are elevated in post-myocardial infarction patients with increased risk for adverse cardiovascular events. PMID: 29657036
  • Acute high-intensity interval exercise decreased irisin levels and increased myostatin levels. PMID: 29558345
  • serum levels were significantly lower in pre-eclampsia than normotensive pregnancies PMID: 29430974
  • Glucocorticoid receptor positively regulates transcription of FNDC5 in the liver. PMID: 28240298
  • This study finds that soccer matches performed different workout times have strong stimulatory effects on irisin levels in all subjects but nesfatin-1 response varied among the subjects and it did not change significantly in afternoon match. PMID: 30084805
  • Results show that Irisin concentration in umbilical cord blood was found to be associated with preterm birth (PTB). On the other hand, no differences in maternal blood irisin levels between mothers with preterm and term deliveries were established. PMID: 29997715
  • Irisin concentrations do not predict risk of developing diabetes prospectively PMID: 29108900
  • serum irisin levels were significantly lower in patients with psoriasis, and associated with serum lipid levels and disease activity; these results can be interpreted that irisin is involved in the disease pathogenesis of patients with psoriasis in relation to metabolic dysregulation PMID: 27652568
  • This study show the serum irisin levels had significant positive correlation with seizure severity Chalfont score and the duration of epilepsy. PMID: 29860632
  • clinical evidence of the association between serum irisin and vascular calcification in HD patients PMID: 29490308
  • The pooled data indicated that the levels of irisin were at least 45.78 ng/ml higher in patients with polycystic ovary syndrome than that in the healthy controls. The current meta-analysis suggested that irisin might contribute to the development of PCOS independent of insulin resistance. PMID: 29069945
  • With adjustment for body mass index, circulating irisin in polycystic ovary syndrome patients seems comparable to healthy controls. [meta-analysis] PMID: 29217128
  • serum irisin levels were lower in Peritoneal Dialysis patients with Protein Energy Wasting than those of the patients without PEW PMID: 29248911
  • Data suggest that decreased irisin levels are associated with metabolic syndrome in prepubertal children; irisin may be a biomarker for metabolic syndrome in prepubertal children. This study was conducted in Seoul, Republic of Korea. PMID: 28904307
  • Findings revealed that irisin may play a critical role in the IL-6-induced epithelialmesenchymal transition of osteosarcoma cells via the STAT3/Snail signaling pathway. PMID: 29048621
  • FNDC5 gene interactions with candidate genes FOXOA3 and APOE PMID: 29143599
  • Irisin is negatively associated with serum testosterone in apopulation sample of men with Metabolic syndrome. PMID: 28759938
  • Irisin replenishment in mCaROCK1 mice partially reversed insulin resistance. PMID: 27411515
  • Suggest that irisin exerts beneficial effect on mood in COPD patients, possibly by inducing the expression of BDNF in brain areas associated with reward-related processes involved in by depression. PMID: 28744117
  • Modulation of Irisin and Physical Activity on Executive Functions in Obesity and Morbid obesity. PMID: 27476477
  • Obese children had significantly higher irisin and lower oxytocin levels than the healthy controls. PMID: 28077341
  • We determined FNDC5 polymorphisms frequencies in the Israeli population and demonstrated that maternal and neonatal FNDC5 rs726344 polymorphism is significantly associated with increased risk for preterm birth. Women bearing FNDC5 rs726344 GG genotype had 2.18 fold higher chance to deliver on time compared to AG and AA genotypes.Neonatal carrying FNDC5 rs726344 GG genotype had 2.24 fold higher chance to be born on time. PMID: 29408625
  • Lower levels of irisin are independently associated with elevated skin AF values, indicating that circulating irisin levels could be associated with AGEs accumulation, which is one of the reasons causing vascular complications in diabetic patients. PMID: 28408433
  • Association of Irisin Plasma Levels with Anthropometric Parameters in Children with Underweight, Normal Weight, Overweight, and Obesity. PMID: 28553647
  • irisin was significantly higher in obese than in control children, and was inversely correlated with Acrp30 and high molecular weight (HMW) oligomers; inverse correlation between Irisin and Acrp30 and, more significantly, between Irisin and HMW oligomers suggests that the two cytokines are closely connected PMID: 28385328
  • Irisin is an oxidative stress marker and a metabolic protective hormone. PMID: 28277125
  • Mild cold exposure increased vasoconstriction with a drop in in-the-ear temperature and these were related. Greater irisin was related to a greater fasting fat oxidation in the absence of shivering PMID: 27006247
  • Activation of the nuclear receptor constitutive androstane receptor (CAR) induced FNDC5 mRNA expression in the liver. PMID: 27007446
  • HCC-liver tissue over-expressed FNDC5/Irisin in association with gene expression of mediators involved in lipogenesis, inflammation and cancer, suggesting a possible protective role of the hormone from the liver damage. PMID: 28012856
  • The secretion of FNDC5 from myotubes and beta-cells in response to exogenous fatty acids, the effects of recombinant FNDC5 on insulin biosynthesis and glucose-stimulated insulin secretion, and beta-cell apoptosis are reported. PMID: 28724742
  • Irisin regulates the number and function of endothelial progenitor cells via the PI3K/Akt/eNOS pathway in mouse model of diabetes mellitus. PMID: 27002278
  • there is a correlation between sport performance, insulin sensitivity, and irisin levels PMID: 28386566
  • results firstly revealed that irisin mitigated oxygen-glucose deprivation-induced neuronal injury in part via inhibiting ROS-NLRP3 inflammatory signaling pathway, suggesting a likely mechanism for irisin-induced therapeutic effect in ischemic stroke. PMID: 28961497
  • These data indicate that increased irisin levels may have protective roles in liver cancer cells through partial activation of the PI3K/AKT pathway, which may facilitate liver cancer progression and decrease the sensitivity to chemotherapy. PMID: 28867187
  • Decreased serum irisin levels are related to emphysema in patients with COPD and involved in epithelial apoptosis, resulting in emphysema. PMID: 28424548
  • Irisin levels are lower in MI and CAD implying that their production may depend on myocardial blood supply. PMID: 28732565
  • findings suggest that irisin plays an important role in metabolic disorders and may be affected by physiopathological status. PMID: 28732566
  • The FNDC5 rs3480 variant is associated with protection from clinically significant fibrosis in patients with NAFLD, while irisin expression is correlated with the severity of NAFLD and may be involved in extracellular matrix deposition. These data suggest that irisin is involved in regulation of hepatic fibrogenesis. PMID: 28472477
  • The median irisin levels were determined higher in T1DM group compared to the control one. PMID: 28222023
  • The modulation of body composition and muscle strength induced by 16-week of resistance training in older women with and without obesity is not associated with changes in circulating Irisin levels. PMID: 28244561
  • serum irisin levels were correlated with anthropometric and metabolic markers of obesity and type 2 diabetes mellitus . PMID: 27220658
  • Plasma irisin modestly increases during moderate and high-intensity afternoon exercise in obese females. PMID: 28125733
  • correlation between irisin and adiposity related factors suggests that that in the case of this clinical model, irisin is regulated by adiposity and not by GH PMID: 27472279
  • Collectively, our study identified serum irisin as a predictive biomarker for 1-year all-cause mortality in acute heart failure patients though large multicenter studies are highly needed. PMID: 28595171
  • T2DM and diabetic nephropathy are associated with decreased levels of irisin. FNDC5 rs16835198 TT genotype associates with decreased risk of T2DM in Egyptians with no effect on renal complications. Also, G allele has insulin desensitizing action with no association with circulating irisin levels. PMID: 28479383
  • irisin might serve as a possible signal for linking body fat/muscle mass with the hypothalamic center governing reproductive function PMID: 27692156
  • Results indicate that cytokines might predict irisin concentration in mothers and their offspring. PMID: 27828992
  • FAQs

    Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

    Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

    Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

    Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

    Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

    Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

    To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.

    Recently viewed