Recombinant Human Fibroblast Growth Factor 8 (FGF8) Protein (His-GST)
Beta LifeScience
SKU/CAT #: BLC-07751P

Greater than 85% as determined by SDS-PAGE.
Recombinant Human Fibroblast Growth Factor 8 (FGF8) Protein (His-GST)
Beta LifeScience
SKU/CAT #: BLC-07751P
Collections: Buy cytokines, chemokines, and growth factors for research online, Explore high-quality enzymes for research and supplementation, Featured enzyme molecules, Growth factors and receptors for advanced research, High-quality cytokines for advanced research, High-quality recombinant proteins, Kinase
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Human Fibroblast Growth Factor 8 (FGF8) Protein (His-GST) is produced by our E.coli expression system. This is a protein fragment. |
Purity | Greater than 85% as determined by SDS-PAGE. |
Uniprotkb | P55075 |
Target Symbol | FGF8 |
Synonyms | FGF-8;Androgen-induced growth factor;AIGF;Heparin-binding growth factor 8;HBGF-8 |
Species | Homo sapiens (Human) |
Expression System | E.coli |
Tag | N-6His-GST |
Target Protein Sequence | QEGPGRGPALGRELASLFRAGREPQGVSQQHVREQSLVTDQLSRRLIRTYQLYSRTSGKHVQVLANKRINAMAEDGDPFAKLIVETDTFGSRVRVRGAETGLYICMNKKGKLIAKSNGKGK |
Expression Range | 23-143aa |
Protein Length | Partial |
Mol. Weight | 44.9 kDa |
Research Area | Cancer |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | Plays an important role in the regulation of embryonic development, cell proliferation, cell differentiation and cell migration. Required for normal brain, eye, ear and limb development during embryogenesis. Required for normal development of the gonadotropin-releasing hormone (GnRH) neuronal system. Plays a role in neurite outgrowth in hippocampal cells. |
Subcellular Location | Secreted. |
Protein Families | Heparin-binding growth factors family |
Database References |
HGNC: 3686 OMIM: 600483 KEGG: hsa:2253 STRING: 9606.ENSP00000321797 UniGene: PMID: 30079292 |