Recombinant Human Fibroblast Growth Factor 17 (FGF17), Active

Beta LifeScience SKU/CAT #: BLC-05941P
Greater than 95% as determined by SDS-PAGE.
Greater than 95% as determined by SDS-PAGE.

Recombinant Human Fibroblast Growth Factor 17 (FGF17), Active

Beta LifeScience SKU/CAT #: BLC-05941P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description Recombinant Human Fibroblast Growth Factor 17 (FGF17), Active is produced by our E.coli expression system. This is a full length protein.
Purity Greater than 95% as determined by SDS-PAGE.
Endotoxin Less than 1.0 EU/μg as determined by LAL method.
Activity The ED50 as determined in a cell proliferation assay using Balb/3T3 mouse embryonic fibroblast cells is less than 3 ug/ml.
Uniprotkb O60258
Target Symbol FGF17
Synonyms FGF 13; FGF 17; FGF-17; FGF13; Fgf17; FGF17_HUMAN; Fibroblast growth factor 17; HH20
Species Homo sapiens (Human)
Expression System E.coli
Tag Tag-Free
Complete Sequence TQGENHPSPNFNQYVRDQGAMTDQLSRRQIREYQLYSRTSGKHVQVTGRRISATAEDGNKFAKLIVETDTFGSRVRIKGAESEKYICMNKRGKLIGKPSGKSKDCVFTEIVLENNYTAFQNARHEGWFMAFTRQGRPRQASRSRQNQREAHFIKRLYQGQLPFPNHAEKQKQFEFVGSAPTRRTKRTRRPQPLT
Expression Range 23-216aa
Protein Length Full Length of Mature Protein
Mol. Weight 22.6 kDa
Research Area Signal Transduction
Form Liquid or Lyophilized powder
Buffer Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4
Storage 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.

Target Details

Target Function Plays an important role in the regulation of embryonic development and as signaling molecule in the induction and patterning of the embryonic brain. Required for normal brain development.
Subcellular Location Secreted.
Protein Families Heparin-binding growth factors family
Database References

HGNC: 3673

OMIM: 603725

KEGG: hsa:8822

STRING: 9606.ENSP00000352414

UniGene: PMID: 23643382

  • FGF17 expression is increased 2-fold in benign prostatic hyperplasia and may contribute to the increased epithelial proliferation seen in this disease. PMID: 15129425

    • FAQs

    Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

    Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

    Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

    Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

    Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

    Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

    To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.

    More from All Products
    Tn5 Transposase
    • Expression system: E.coli;
    CAT#: TN5-BL01
    Sale
    SDS-PAGE analysis of Human NDUFV1 (Nadh Dehydrogenase [Ubiquinone] Flavoprotein 1, Mitochondrial) - Recombinant Protein, CAT# BLT-08321P, showing >90% purity under 15% SDS-PAGE (Reduced)
    Human NDUFV1 (Nadh Dehydrogenase [Ubiquinone] Flavoprotein 1, Mitochondrial) - Recombinant Protein
    • Molecule: NDUFV1;
    • Species: Human;
    • Expression system: E.coli;
    • Tag: N-6His+SUMO;
    • Sequence: 21-464aa;
    CAT#: BLT-08321P

    Save $139
    Sale
    SDS-PAGE analysis of Human USP9X (Ubiquitin Carboxyl-Terminal Hydrolase 9X) - Recombinant Protein, CAT# BLT-07739P, showing >90% purity under 15% SDS-PAGE (Reduced)
    Human USP9X (Ubiquitin Carboxyl-Terminal Hydrolase 9X) - Recombinant Protein
    • Molecule: USP9X;
    • Species: Human;
    • Expression system: E.coli;
    • Tag: N-GST;
    • Sequence: 1554-1995aa;
    CAT#: BLT-07739P

    Save $139
    Sale
    SDS-PAGE analysis of Human GFAP (Glial Fibrillary Acidic Protein) - Recombinant Protein, CAT# BLT-07373P, showing >90% purity under 15% SDS-PAGE (Reduced)
    Human GFAP (Glial Fibrillary Acidic Protein) - Recombinant Protein
    • Molecule: GFAP;
    • Species: Human;
    • Expression system: E.coli;
    • Tag: N-6His;
    • Sequence: 1-432aa;
    CAT#: BLT-07373P

    Save $139
    Sale
    SDS-PAGE analysis of Human SFTPA2 (Pulmonary Surfactant-Associated Protein A2) - Recombinant Protein, CAT# BLT-08789P showing >90% purity under 15% SDS-PAGE (Reduced)
    Human SFTPA2 (Pulmonary Surfactant-Associated Protein A2) - Recombinant Protein
    • Molecule: SFTPA2;
    • Species: Human;
    • Expression system: E.coli;
    • Tag: N-6His;
    • Sequence: 21-248;
    CAT#: BLT-08789P

    Save $139
    Sale
    SDS-PAGE analysis of Human CFTR (Cystic Fibrosis Transmembrane Conductance Regulator) - Recombinant Protein, CAT# BLT-07667P, showing >90% purity under 15% SDS-PAGE (Reduced)
    Human CFTR (Cystic Fibrosis Transmembrane Conductance Regulator) - Recombinant Protein
    • Molecule: CFTR;
    • Species: Human;
    • Expression system: E.coli;
    • Tag: N-6His;
    • Sequence: 359-858aa;
    CAT#: BLT-07667P

    Save $139
    Recently viewed