Recombinant Human Fibroblast Growth Factor 12 (FGF12), Active
Beta LifeScience
SKU/CAT #: BLC-05932P
Greater than 95% as determined by SDS-PAGE.
Recombinant Human Fibroblast Growth Factor 12 (FGF12), Active
Beta LifeScience
SKU/CAT #: BLC-05932P
Collections: All products, Buy cytokines, chemokines, and growth factors for research online, Explore high-quality enzymes for research and supplementation, Featured enzyme molecules, Growth factors and receptors for advanced research, High-quality cytokines for advanced research, High-quality recombinant proteins, Kinase
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Human Fibroblast Growth Factor 12 (FGF12), Active is produced by our E.coli expression system. This is a full length protein. |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| Endotoxin | Less than 1.0 EU/μg as determined by LAL method. |
| Activity | The ED50 as determined by its ability to bind Human FGF R3 in functional ELISA is less than 20 ug/ml. |
| Uniprotkb | P61328 |
| Target Symbol | FGF12 |
| Synonyms | EIEE47; FGF-12; Fgf12; FGF12_HUMAN; FGF12B; FHF-1; FHF1; Fibroblast growth factor 12; Fibroblast growth factor 12B; Fibroblast growth factor FGF 12b; Fibroblast growth factor homologous factor 1; Myocyte activating factor; Myocyte-activating factor |
| Species | Homo sapiens (Human) |
| Expression System | E.coli |
| Tag | Tag-Free |
| Complete Sequence | MESKEPQLKGIVTRLFSQQGYFLQMHPDGTIDGTKDENSDYTLFNLIPVGLRVVAIQGVKASLYVAMNGEGYLYSSDVFTPECKFKESVFENYYVIYSSTLYRQQESGRAWFLGLNKEGQIMKGNRVKKTKPSSHFVPKPIEVCMYREPSLHEIGEKQGRSRKSSGTPTMNGGKVVNQDST |
| Expression Range | 1-181aa |
| Protein Length | Full Length of Isoform?2 |
| Mol. Weight | 20.45 kDa |
| Research Area | Cardiovascular |
| Form | Lyophilized powder |
| Buffer | Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, 5 mM EDTA, pH 7.5 |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Involved in nervous system development and function. Involved in the positive regulation of voltage-gated sodium channel activity. Promotes neuronal excitability by elevating the voltage dependence of neuronal sodium channel SCN8A fast inactivation. |
| Subcellular Location | Nucleus. |
| Protein Families | Heparin-binding growth factors family |
| Database References | HGNC: 3668 OMIM: 601513 KEGG: hsa:2257 STRING: 9606.ENSP00000413496 UniGene: PMID: 29049013 |
