Recombinant Human Fibrinogen-Like Protein 1 (FGL1) Protein (Fc-Myc)

Name: Recombinant Human Fibrinogen-Like Protein 1 (FGL1) Protein (Fc-Myc)
Brand: Beta LifeScience
SKU: BLC-00040P
Price: 299.0 USD
Availability: InStock

Greater than 85% as determined by SDS-PAGE.

Price Save $1,549

Size

100ug

Product Overview

Description	Recombinant Human Fibrinogen-Like Protein 1 (FGL1) Protein (Fc-Myc) is produced by our Mammalian cell expression system. This is a full length protein.
Purity	Greater than 85% as determined by SDS-PAGE.
Uniprotkb	Q08830
Target Symbol	FGL1
Synonyms	FGL 1; Fgl1; FGL1_HUMAN; Fibrinogen like 1; Fibrinogen like protein 1; Fibrinogen related protein 1; Fibrinogen-like protein 1; Hepassocin; Hepatocellular carcinoma related sequence; Hepatocyte derived fibrinogen related protein 1; Hepatocyte-derived fibrinogen-related protein 1; HFREP 1; HFREP-1; HFREP1; HP 041; HP-041; HP041; LFIRE 1; LFIRE-1; LFIRE1; Liver fibrinogen related protein 1; Liver fibrinogen-related protein 1; MFIRE 1; MGC108569; MGC12455; MGC37822; OTTHUMP00000122468
Species	Homo sapiens (Human)
Expression System	Mammalian cell
Tag	C-FC-Myc
Target Protein Sequence	LEDCAQEQMRLRAQVRLLETRVKQQQVKIKQLLQENEVQFLDKGDENTVIDLGSKRQYADCSEIFNDGYKLSGFYKIKPLQSPAEFSVYCDMSDGGGWTVIQRRSDGSENFNRGWKDYENGFGNFVQKHGEYWLGNKNLHFLTTQEDYTLKIDLADFEKNSRYAQYKNFKVGDEKNFYELNIGEYSGTAGDSLAGNFHPEVQWWASHQRMKFSTWDRDHDNYEGNCAEEDQSGWWFNRCHSANLNGVYYSGPYTAKTDNGIVWYTWHGWWYSLKSVVMKIRPNDFIPNVI
Expression Range	23-312aa
Protein Length	Full Length of Mature Protein
Mol. Weight	64.09999999999999
Research Area	Cardiovascular
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Immune suppressive molecule that inhibits antigen-specific T-cell activation by acting as a major ligand of LAG3. Responsible for LAG3 T-cell inhibitory function. Binds LAG3 independently from MHC class II (MHC-II). Secreted by, and promotes growth of, hepatocytes.
Subcellular Location	Secreted.
Database References	HGNC: 3695 OMIM: 605776 KEGG: hsa:2267 STRING: 9606.ENSP00000221204 UniGene: Hs.491143
Tissue Specificity	Under normal conditions, liver-specific.

Gene Functions References

FGL1 promotes invasion and metastasis of gastric cancer and is associated with poor prognosis. PMID: 29845203
findings highlight the crucial role of HFREP1 in insulin resistance and diabetes, and provide a potential strategy and biomarker for developing therapeutic approaches to combat these diseases. PMID: 27221093
Hepassocin plays an important role in non-alcoholic fatty liver disease and induces hepatic lipid accumulation through an ERK1/2-dependent pathway. PMID: 23792031
Here, the application of small ubiquitin-related modifier (SUMO) fusion technology in combination with four different chaperone teams on the soluble expression of recombinant HPS protein was explored and analyzed. PMID: 24084006
Findings suggest that hepassocin promotes hepatic cell line L02 cells proliferation via an autocrine mechanism and inhibits HCC cells proliferation by an intracrine pathway. PMID: 21618590
data demonstrated that liver-specific gene LFIRE-1/HFREP-1 was frequently downregulated and might possess growth suppressor activity in HCC PMID: 14981537
HFREP-1 in plasma almost completely bound to the fibrin matrix during clot formation PMID: 16996032
The enhancement of FGL1 levels in vitro by IL-6 and its induction after turpentine oil injection suggest that it is an acute phase reactant. PMID: 18039467
HNF1 binding site and HNF1alpha are critical to liver-specific expression of HPS, and down-regulation or loss of HNF1alpha causes, at least in part, the transcriptional down-regulation of HPS in HCC. PMID: 19304666

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.