Recombinant Human Fc Receptor-Like Protein 6 (FCRL6) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-10420P
Greater than 90% as determined by SDS-PAGE.
Recombinant Human Fc Receptor-Like Protein 6 (FCRL6) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-10420P
Collections: Fc receptors, Featured fc receptors molecules, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Human Fc Receptor-Like Protein 6 (FCRL6) Protein (His) is produced by our Yeast expression system. This is a extracellular protein. |
Purity | Greater than 90% as determined by SDS-PAGE. |
Uniprotkb | Q6DN72 |
Target Symbol | FCRL6 |
Synonyms | Fc receptor homolog 6; Fc receptor-like 6; Fc receptor-like protein 6; Fc receptor-like protein 7; FcR-like protein 6; FcRH6; FcRL6; FCRL6_HUMAN; FLJ16056; IFGP6; IgSF type I transmembrane receptor; leukocyte receptor |
Species | Homo sapiens (Human) |
Expression System | Yeast |
Tag | N-6His |
Target Protein Sequence | LYLQAWPNPVFEGDALTLRCQGWKNTPLSQVKFYRDGKFLHFSKENQTLSMGAATVQSRGQYSCSGQVMYIPQTFTQTSETAMVQVQELFPPPVLSAIPSPEPREGSLVTLRCQTKLHPLRSALRLLFSFHKDGHTLQDRGPHPELCIPGAKEGDSGLYWCEVAPEGGQVQKQSPQLEVRVQAPVSRPVLTLHHGPADPAVGDMVQLLCEAQRGSPPILYSFYLDEKIVGNHSAPCGGTTSLLFPVKSEQDAGNYSCEAENSVSRERSEPKKLSLKGSQVLFTPASNW |
Expression Range | 20-307aa |
Protein Length | Extracellular Domain |
Mol. Weight | 33.7kDa |
Research Area | Immunology |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | Acts as a MHC class II receptor. When stimulated on its own, does not play a role in cytokine production or the release of cytotoxic granules by NK cells and cytotoxic CD8(+) T cells. Does not act as an Fc receptor. |
Subcellular Location | Cell membrane; Single-pass type I membrane protein. |
Database References | |
Tissue Specificity | Expressed by cytolytic cells including NK cells, effector and effector-memory CD8(+) T-cells, and a subset of NKT cells (at protein level). Also expressed in gamma delta T cells and in a rare subset of effector CD4(+) T-cells (at protein level). Expressed |
Gene Functions References
- Human FCRL6 receptor, selectively expressed by cytotoxic T and natural killer (NK) cells, directly binds the major histocompatibility complex (MHC) class II molecule HLA-DR. PMID: 20519654
- FCRL6 is a distinct indicator of cytotoxic effector lymphocytes that is upregulated in diseases characterized by chronic immune stimulation. PMID: 18991291