Recombinant Human Fatty Acid-Binding Protein 5 (FABP5) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-07804P
Greater than 90% as determined by SDS-PAGE.
Recombinant Human Fatty Acid-Binding Protein 5 (FABP5) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-07804P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Human Fatty Acid-Binding Protein 5 (FABP5) Protein (His) is produced by our E.coli expression system. This is a full length protein. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Uniprotkb | Q01469 |
| Target Symbol | FABP5 |
| Synonyms | Epidermal-type fatty acid-binding protein1 Publication E-FABP1 Publication Fatty acid-binding protein, epidermal Psoriasis-associated fatty acid-binding protein homolog |
| Species | Homo sapiens (Human) |
| Expression System | E.coli |
| Tag | N-10His |
| Target Protein Sequence | MATVQQLEGRWRLVDSKGFDEYMKELGVGIALRKMGAMAKPDCIITCDGKNLTIKTESTLKTTQFSCTLGEKFEETTADGRKTQTVCNFTDGALVQHQEWDGKESTITRKLKDGKLVVECVMNNVTCTRIYEKVE |
| Expression Range | 1-135aa |
| Protein Length | Full Length |
| Mol. Weight | 21.2 kDa |
| Research Area | Cardiovascular |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Intracellular carrier for long-chain fatty acids and related active lipids, such as endocannabinoids, that regulate the metabolism and actions of the ligands they bind. In addition to the cytosolic transport, selectively delivers specific fatty acids from the cytosol to the nucleus, wherein they activate nuclear receptors. Delivers retinoic acid to the nuclear receptor peroxisome proliferator-activated receptor delta; which promotes proliferation and survival. May also serve as a synaptic carrier of endocannabinoid at central synapses and thus controls retrograde endocannabinoid signaling. Modulates inflammation by regulating PTGES induction via NF-kappa-B activation, and prostaglandin E2 (PGE2) biosynthesis during inflammation. May be involved in keratinocyte differentiation. |
| Subcellular Location | Cytoplasm. Nucleus. Cell junction, synapse. Cell junction, synapse, postsynaptic density. Secreted. |
| Protein Families | Calycin superfamily, Fatty-acid binding protein (FABP) family |
| Database References | HGNC: 3560 OMIM: 605168 KEGG: hsa:2171 STRING: 9606.ENSP00000297258 UniGene: PMID: 29957468 |
