Recombinant Human Excitatory Amino Acid Transporter 1 (SLC1A3) Protein (His-KSI)
Beta LifeScience
SKU/CAT #: BLC-01560P
Greater than 85% as determined by SDS-PAGE.
Recombinant Human Excitatory Amino Acid Transporter 1 (SLC1A3) Protein (His-KSI)
Beta LifeScience
SKU/CAT #: BLC-01560P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Human Excitatory Amino Acid Transporter 1 (SLC1A3) Protein (His-KSI) is produced by our E.coli expression system. This is a protein fragment. |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| Uniprotkb | P43003 |
| Target Symbol | SLC1A3 |
| Synonyms | Sodium-dependent glutamate/aspartate transporter 1;GLAST-1;Solute carrier family 1 member 3 |
| Species | Homo sapiens (Human) |
| Expression System | E.coli |
| Tag | N-6His-KSI |
| Target Protein Sequence | HPGKGTKENMHREGKIVRVTAADAFLDLIRNMFPPNLVEACFKQFKTNYEKRSFKVPIQANETLVGAVINNVSEAMETLTRITEELVPVPG |
| Expression Range | 146-236aa |
| Protein Length | Partial |
| Mol. Weight | 25.5 kDa |
| Research Area | Neuroscience |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Sodium-dependent, high-affinity amino acid transporter that mediates the uptake of L-glutamate and also L-aspartate and D-aspartate. Functions as a symporter that transports one amino acid molecule together with two or three Na(+) ions and one proton, in parallel with the counter-transport of one K(+) ion. Mediates Cl(-) flux that is not coupled to amino acid transport; this avoids the accumulation of negative charges due to aspartate and Na(+) symport. Plays a redundant role in the rapid removal of released glutamate from the synaptic cleft, which is essential for terminating the postsynaptic action of glutamate. |
| Subcellular Location | Cell membrane; Multi-pass membrane protein. |
| Protein Families | Dicarboxylate/amino acid:cation symporter (DAACS) (TC 2.A.23) family, SLC1A3 subfamily |
| Database References | HGNC: 10941 OMIM: 600111 KEGG: hsa:6507 STRING: 9606.ENSP00000265113 UniGene: PMID: 30073554 |
