Recombinant Human Eukaryotic Translation Initiation Factor 4E-Binding Protein 2 (EIF4EBP2) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-09558P
Greater than 90% as determined by SDS-PAGE.
Recombinant Human Eukaryotic Translation Initiation Factor 4E-Binding Protein 2 (EIF4EBP2) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-09558P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Human Eukaryotic Translation Initiation Factor 4E-Binding Protein 2 (EIF4EBP2) Protein (His) is produced by our Yeast expression system. This is a full length protein. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Uniprotkb | Q13542 |
| Target Symbol | EIF4EBP2 |
| Synonyms | 4E-BP2; 4EBP2; 4EBP2_HUMAN; eIF4E binding protein 2; eIF4E-binding protein 2; Eif4ebp2; Eukaryotic translation initiation factor 4E binding protein 1; Eukaryotic translation initiation factor 4E-binding protein 2; PHASII; phosphorylated; heat and acid stable regulated by insulin protein II |
| Species | Homo sapiens (Human) |
| Expression System | Yeast |
| Tag | N-6His |
| Target Protein Sequence | MSSSAGSGHQPSQSRAIPTRTVAISDAAQLPHDYCTTPGGTLFSTTPGGTRIIYDRKFLLDRRNSPMAQTPPCHLPNIPGVTSPGTLIEDSKVEVNNLNNLNNHDRKHAVGDDAQFEMDI |
| Expression Range | 1-120aa |
| Protein Length | Full Length |
| Mol. Weight | 14.9kDa |
| Research Area | Transcription |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Repressor of translation initiation involved in synaptic plasticity, learning and memory formation. Regulates EIF4E activity by preventing its assembly into the eIF4F complex: hypophosphorylated form of EIF4EBP2 competes with EIF4G1/EIF4G3 and strongly binds to EIF4E, leading to repress translation. In contrast, hyperphosphorylated form dissociates from EIF4E, allowing interaction between EIF4G1/EIF4G3 and EIF4E, leading to initiation of translation. EIF4EBP2 is enriched in brain and acts as a regulator of synapse activity and neuronal stem cell renewal via its ability to repress translation initiation. Mediates the regulation of protein translation by hormones, growth factors and other stimuli that signal through the MAP kinase and mTORC1 pathways. |
| Protein Families | EIF4E-binding protein family |
| Database References | HGNC: 3289 OMIM: 602224 KEGG: hsa:1979 STRING: 9606.ENSP00000362314 UniGene: PMID: 28068774 |
