Recombinant Human Eukaryotic Translation Elongation Factor 1 Epsilon-1 (EEF1E1) Protein (His-SUMO)

Name: Recombinant Human Eukaryotic Translation Elongation Factor 1 Epsilon-1 (EEF1E1) Protein (His-SUMO)
Brand: Beta LifeScience
SKU: BLC-09869P
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Product Overview

Description	Recombinant Human Eukaryotic Translation Elongation Factor 1 Epsilon-1 (EEF1E1) Protein (His-SUMO) is produced by our E.coli expression system. This is a full length protein.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	O43324
Target Symbol	EEF1E1
Synonyms	AIMP 3; AIMP3; Aminoacyl tRNA synthetase complex interacting multifunctional protein 3; Aminoacyl tRNA synthetase complex-interacting multifunctional protein 3; ARS interacting multifunctional protein 3; EEF1E1; Elongation factor p18; Eukaryotic translation elongation factor 1 epsilon 1; Eukaryotic translation elongation factor 1 epsilon-1; Homolog of rat elongation factor p18; MCA3_HUMAN; Multisynthase complex auxiliary component p18; Multisynthetase complex auxiliary component p18; p18; p18 component of aminoacyl tRNA synthetase complex
Species	Homo sapiens (Human)
Expression System	E.coli
Tag	N-6His-SUMO
Target Protein Sequence	AAAAELSLLEKSLGLSKGNKYSAQGERQIPVLQTNNGPSLTGLTTIAAHLVKQANKEYLLGSTAEEKAIVQQWLEYRVTQVDGHSSKNDIHTLLKDLNSYLEDKVYLTGYNFTLADILLYYGLHRFIVDLTVQEKEKYLNVSRWFCHIQHYPGIRQHLSSVVFIKNRLYTNSH
Expression Range	2-174aa
Protein Length	Full Length of Mature Protein
Mol. Weight	35.7kDa
Research Area	Metabolism
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Positive modulator of ATM response to DNA damage.
Subcellular Location	Cytoplasm. Cytoplasm, cytosol. Nucleus. Note=Cytoplasmic under growth arrest conditions. Translocated into the nucleus when growth resumes (S phase) and following DNA damage.
Database References	HGNC: 3212 OMIM: 609206 KEGG: hsa:9521 STRING: 9606.ENSP00000369038 UniGene: Hs.602353
Tissue Specificity	Down-regulated in various cancer tissues.

Gene Functions References

LmnA binds AIMP3 via its extreme C-terminus. Together these findings provide a structural insight for understanding the interaction between AIMP3 and LmnA in AIMP3 degradation. PMID: 28797100
AIMP3 was shown to be involved in the cellular aging of human mesenchymal stem cells. PMID: 25465621
Identification of EEf1E1 and OBFC2B as novel BRCA1-partner genes in the DNA double-strand break repair pathway. PMID: 24104880
AIMP3 stabilizes and protects methionyl-tRNA synthetase and eIF2gamma through the binding interactions. PMID: 23306449
AIMP3 is a critical mediator of Met-tRNA(i)(Met) transfer from methionyl-tRNA synthetase to eIF2 complex for the accurate and efficient translation initiation PMID: 22867704
Data show that aminoacyl-tRNA synthetase-interacting multifunctional protein-3 (AIMP3)/p18 is released from aminoacyl-tRNA synthetase-interacting multifunctional protein-3 (AIMP3) by UV irradiation-induced stress. PMID: 22106287
Decreased expression of AIMP3 in gastric and colorectal cancer tissues suggests that down-regulation of this protein may be related to inactivation of the tumor suppressor functions of AIMP proteins and might play a role in the development of GC and CRC. PMID: 21789020
p18 is a haploinsufficient tumor suppressor and a key factor for ATM/ATR-mediated p53 activation. PMID: 15680327
analysis of the three-dimensional structure and residues of the novel tumor suppressor AIMP3/p18 required for the interaction with PMID: 18343821
No EEF1E1 mutations were detected in human cancer specimens. PMID: 19024604

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.