Recombinant Human Estradiol 17-Beta-Dehydrogenase 11 (HSD17B11) Protein (His&Myc)
Beta LifeScience
SKU/CAT #: BLC-00592P
Greater than 85% as determined by SDS-PAGE.
Recombinant Human Estradiol 17-Beta-Dehydrogenase 11 (HSD17B11) Protein (His&Myc)
Beta LifeScience
SKU/CAT #: BLC-00592P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Human Estradiol 17-Beta-Dehydrogenase 11 (HSD17B11) Protein (His&Myc) is produced by our E.coli expression system. This is a full length protein. |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| Uniprotkb | Q8NBQ5 |
| Target Symbol | HSD17B11 |
| Synonyms | (17-beta-hydroxysteroid dehydrogenase 11)(17-beta-HSD 11)(17bHSD11)(17betaHSD11)(17-beta-hydroxysteroid dehydrogenase XI)(17-beta-HSD XI)(17betaHSDXI)(Cutaneous T-cell lymphoma-associated antigen HD-CL-03)(CTCL-associated antigen HD-CL-03)(Dehydrogenase/reductase SDR family member 8)(Retinal short-chain dehydrogenase/reductase 2)(retSDR2)(Short chain dehydrogenase/reductase family 16C member 2) |
| Species | Homo sapiens (Human) |
| Expression System | E.coli |
| Tag | N-10His&C-Myc |
| Target Protein Sequence | ESFVKLFIPKRRKSVTGEIVLITGAGHGIGRLTAYEFAKLKSKLVLWDINKHGLEETAAKCKGLGAKVHTFVVDCSNREDIYSSAKKVKAEIGDVSILVNNAGVVYTSDLFATQDPQIEKTFEVNVLAHFWTTKAFLPAMTKNNHGHIVTVASAAGHVSVPFLLAYCSSKFAAVGFHKTLTDELAALQITGVKTTCLCPNFVNTGFIKNPSTSLGPTLEPEEVVNRLMHGILTEQKMIFIPSSIAFLTTLERILPERFLAVLKQKISVKFDAVIGYKMKAQ |
| Expression Range | 20-300aa |
| Protein Length | Full Length of Mature Protein |
| Mol. Weight | 35.8 kDa |
| Research Area | Metabolism |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Can convert androstan-3-alpha,17-beta-diol (3-alpha-diol) to androsterone in vitro, suggesting that it may participate in androgen metabolism during steroidogenesis. May act by metabolizing compounds that stimulate steroid synthesis and/or by generating metabolites that inhibit it. Has no activity toward DHEA (dehydroepiandrosterone), or A-dione (4-androste-3,17-dione), and only a slight activity toward testosterone to A-dione. Tumor-associated antigen in cutaneous T-cell lymphoma. |
| Subcellular Location | Endoplasmic reticulum. Lipid droplet. |
| Protein Families | Short-chain dehydrogenases/reductases (SDR) family, 17-beta-HSD 3 subfamily |
| Database References | HGNC: 22960 OMIM: 612831 KEGG: hsa:51170 STRING: 9606.ENSP00000351035 UniGene: PMID: 26472732 |
