Recombinant Human Erythropoietin (EPO) Protein (His), Active
Beta LifeScience
SKU/CAT #: BLC-05911P
Greater than 95% as determined by SDS-PAGE.
Recombinant Human Erythropoietin (EPO) Protein (His), Active
Beta LifeScience
SKU/CAT #: BLC-05911P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Human Erythropoietin (EPO) Protein (His), Active is produced by our Mammalian cell expression system. This is a full length protein. |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| Endotoxin | Less than 1.0 EU/μg as determined by LAL method. |
| Activity | The ED50 as determined in a cell proliferation assay using TF-1 human erythroleukemic cells is less than 5 ng/ml |
| Uniprotkb | P01588 |
| Target Symbol | EPO |
| Synonyms | EPOErythropoietin; Epoetin |
| Species | Homo sapiens (Human) |
| Expression System | Mammalian cell |
| Tag | C-6His |
| Complete Sequence | APPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYAWKRMEVGQQAVEVWQGLALLSEAVLRGQALLVNSSQPWEPLQLHVDKAVSGLRSLTTLLRALGAQKEAISPPDAASAAPLRTITADTFRKLFRVYSNFLRGKLKLYTGEACRTGDR |
| Expression Range | 28-193aa |
| Protein Length | Full Length of Mature Protein |
| Mol. Weight | 19.2 kDa |
| Research Area | Signal Transduction |
| Form | Lyophilized powder |
| Buffer | Lyophilized from a 0.2 μm filtered 1xPBS, pH 7.4 |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Hormone involved in the regulation of erythrocyte proliferation and differentiation and the maintenance of a physiological level of circulating erythrocyte mass. Binds to EPOR leading to EPOR dimerization and JAK2 activation thereby activating specific downstream effectors, including STAT1 and STAT3. |
| Subcellular Location | Secreted. |
| Protein Families | EPO/TPO family |
| Database References | HGNC: 3415 OMIM: 133170 KEGG: hsa:2056 STRING: 9606.ENSP00000252723 UniGene: PMID: 29395333 |
