Recombinant Human Epithelial Cell Adhesion Molecule (EPCAM) Protein (His-SUMO)

Name: Recombinant Human Epithelial Cell Adhesion Molecule (EPCAM) Protein (His-SUMO)
Brand: Beta LifeScience
SKU: BLC-02940P
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of this product could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) EPCAM.

Collections: All products, Antibody / cell therapy targets, Antibody therapeutic / adc target proteins, Car-nk targets proteins, High-quality recombinant proteins, Recombinant cell therapy targets for car-t research

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human Epithelial Cell Adhesion Molecule (EPCAM) Protein (His-SUMO) is produced by our E.coli expression system. This is a protein fragment.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	P16422
Target Symbol	EPCAM
Synonyms	17 1A; 323/A3; Adenocarcinoma associated antigen; Adenocarcinoma-associated antigen; Antigen identified by monoclonal AUA1; AUA1; CD326; CD326 antigen; Cell surface glycoprotein Trop 1; Cell surface glycoprotein Trop 2; Cell surface glycoprotein Trop-1; CO 17A; CO17 1A; CO17A; DIAR5; EGP 2; EGP; EGP2; EGP314; EGP40; Ep CAM; Ep-CAM; EPCAM; EPCAM_HUMAN; EpCAM1; Epithelial cell adhesion molecule; Epithelial Cell Adhesion Molecule Intracellular Domain (EpCAM-ICD); Epithelial cell surface antigen; Epithelial cellular adhesion molecule; Epithelial glycoprotein 1; Epithelial glycoprotein 314; Epithelial glycoprotein; ESA; GA733 1; GA733 2; GA733-2; gastrointestinal tumor-associated antigen 2; 35-KD glycoprotein; gp4; hEGP 2; hEGP314; HNPCC8; Human epithelial glycoprotein 2; KS 1/4 antigen; KS1/4; KSA; Ly74; Lymphocyte antigen 74; M1S 1; M1S2; M4S1; Major gastrointestinal tumor associated protein GA733 2; Major gastrointestinal tumor-associated protein GA733-2; mEGP314; Membrane component chromosome 4 surface marker (35kD glycoprotein); Membrane component; chromosome 4; surface marker 1; Membrane component; chromosome 4; surface marker; MIC18; MK 1; Protein 289A; TACD1; TACSTD1; TROP1; Tumor associated calcium signal transducer 1; Tumor associated calcium signal transducer 2 precursor; Tumor-associated calcium signal transducer 1
Species	Homo sapiens (Human)
Expression System	E.coli
Tag	N-6His-SUMO
Target Protein Sequence	QEECVCENYKLAVNCFVNNNRQCQCTSVGAQNTVICSKLAAKCLVMKAEMNGSKLGRRAKPEGALQNNDGLYDPDCDESGLFKAKQCNGTSMCWCVNTAGVRRTDKDTEITCSERVRTYWIIIELKHKAREKPYDSKSLRTALQKEITTRYQLDPKFITSILYENNVITIDLVQNSSQKTQNDVDIADVAYYFEKDVKGESLFHSKKMDLTVNGEQLDLDPGQTLIYYVDEKAPEFSMQGLK
Expression Range	24-265aa
Protein Length	Partial
Mol. Weight	43.4kDa
Research Area	Tags & Cell Markers
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	May act as a physical homophilic interaction molecule between intestinal epithelial cells (IECs) and intraepithelial lymphocytes (IELs) at the mucosal epithelium for providing immunological barrier as a first line of defense against mucosal infection. Plays a role in embryonic stem cells proliferation and differentiation. Up-regulates the expression of FABP5, MYC and cyclins A and E.
Subcellular Location	Lateral cell membrane; Single-pass type I membrane protein. Cell junction, tight junction.
Protein Families	EPCAM family
Database References	HGNC: 11529 OMIM: 185535 KEGG: hsa:4072 STRING: 9606.ENSP00000263735 UniGene: PMID: 29352248 Functions of EpCAM in physiological processes and diseases (Review). PMID: 30015855 Our results suggest that GA733-2-Fc conjugated to ER-retention motif KDEL is a more efficient antigen to prevent tumor growth induced by colorectal carcinoma and minimize an allergic response. PMID: 30249898 extracellular vesicles tend to localize in the intestinal tract associated with epithelial cell adhesion molecule PMID: 27721471 Overexpression of EpCAM and melan-A is associated with malignant melanoma. PMID: 29076925 Quercetin suppressed breast cancer stem cell proliferation, self-renewal, and invasiveness. It also lowered the expression levels of proteins related to tumorigenesis and cancer progression, such as aldehyde dehydrogenase 1A1, C-X-C chemokine receptor type 4, mucin 1, and epithelial cell adhesion molecules. PMID: 29353288 Adenocarcinomas showed significantly higher staining scores of both VEGF and alphaSMA than squamous cell carcinomas did. In 42 cases of high CD31 score, five-year survival rate (87%) of patients with lung cancer showing mature tumor vessels was significantly better than that (69%) of patients with immature tumor vessels PMID: 29970536 New EPCAM founder deletion causing Lynch Syndrome has been described in Polish population. PMID: 28369810 The novel and updated insights in the EpCAM field by simplifying the understanding of the biological role of this fascinating molecule, and by showing the promising therapeutic tools that have been developed by various approaches which use antibodies and vaccines for different cancer types for the clear purpose of improving patient outcome. [review] PMID: 29759567 This is the first demonstration that the low sensitivity of CellSearch(R) to detect circulating tumor cells in colorectal cancer patients is not due to the lack of EpCAM PMID: 28604994 Findings indicate that epithelial cell adhesion molecule (EpCAM) can be used as an additional distinction-marker for cystic lesions of the sellar region. PMID: 27431859 Data indicate that epithelial cell adhesion molecule (EpCAM) show high tumor distinctiveness. PMID: 28820475 Low expressions of Oct4-EpCAM in IHC and CD133 in qPCR may reveal roles in gastric cancer PMID: 27557490 EpCAM expression contributes to tumor resistance to chemotherapy in patients with ovarian cancer. PMID: 28574829 The present findings suggest that Ep-CAM expression may be associated with CRC carcinogenesis, while the loss of Ep-CAM expression is correlated with the progression, metastasis, and poor prognosis of CRC. Ep-CAM expression may be a useful biomarker for the clinical diagnosis of CRC. PMID: 28558958 the present study identified a positive correlation between EpCAM and COX-2 expression in breast cancer cell lines and tissue specimens. EpCAM and COX-2 were associated with the prognosis of breast cancer patients. PMID: 28393249 CD133+ cells were genetically heterogeneous among patients without any defined profile compared to CD133-/EpCAM+ cells. PMID: 28347289 Combining the targets E-cadherin, epithelial membrane antigen (EMA), human epidermal growth receptor type 2 (Her2/neu), carcinoembryonic antigen (CEA) resulted in nearly 100% detection of ductal ovarian metastases, whereas the combination of EMA, Her2/neu and epithelial cell adhesion molecule (EpCAM) was most suitable to detect lobular ovarian metastases. PMID: 28327103 Whole-genome sequencing identified the homozygous intronic variant EPCAM c.556-14A>G, considered explanatory for the patient's intractable diarrhea and providing a diagnosis of congenital tufting enteropathy. PMID: 28701297 Low EPCAM expression is associated with colorectal carcinoma. PMID: 26528695 Our study provided clinical evidence for EpCAM intracellular domain as a predictor of cancer development in patients with oral dysplasia and recurrence in oral squamous cell carcinoma patients PMID: 27421772 Elevated epithelial cell adhesion molecule EpCAM (mRNA+) CTC and Treg/CD4(+) levels were associated with early recurrence of hepatocellular carcinoma (HCC), indicative of poor clinical outcome. PMID: 27439521 Observations provide important insights into the regulation of EpCAM expression during EMT, demonstrate an unexpected role for EpCAM in the regulation of ERK and define a novel double-negative feedback loop between EpCAM and ERK that contributes to the regulation of EMT. PMID: 28192403 This study shows the potential of an EpCAM specific NIR-fluorescent agent in combination with a clinically validated intraoperative imaging system to visualize various tumours during surgery. PMID: 27842504 The studies identified the characteristics and function of EpCAM glycosylation sites on breast cancer cell adhesion. PMID: 28315854 These results identify EpCAM as a substrate of matriptase and link HAI-2, matriptase, EpCAM, and claudin-7 in a functionally important pathway that causes disease when it is dysregulated. PMID: 28094766 The EpCAM aptamer conjugated NCS showed specificity to EpCAM-positive cells. PMID: 28668853 Pseudomyxoma peritonei ubiquitously express CEA and EpCAM. PMID: 27038681 relationship between EpCAM-regulated transcription and altered biophysical properties of cells that promoteepithelial-mesenchymal transition (EMT) in advanced endometrial cancer. PMID: 27569206 used a next generation sequencing (NGS) approach. NY-SAR-35 expression induced growth, proliferation, metastasis, and stemness genes, as indicated by the up-regulations of CXCR4, EpCAM, CD133, and CD44, at the mRNA and protein levels PMID: 28126340 These results indicate that adipocyte-secreted factors might regulate cancer stem cell behavior through several signaling molecules including c-Met, STAT3 and ERK1/2 and inhibition of these signaling pathways offer novel strategies in targeting the effect of adipose-derived cytokines in cancer. PMID: 27131739 The meta-analysis demonstrated that the expression of EpCAM in the gastric cancer group was greater than that in the control group. Moreover, EpCAM overexpression was associated with larger tumour size, lymphnode metastasis and worse prognosis in gastric cancer. [review] PMID: 28403178 expression of EpCAM(MT) is associated with a more aggressive phenotype and predicts poor survival in patients with colorectal cancer. PMID: 26996277 Higher levels of epithelial cell adhesion molecule (EpCAM) in breast cancer may be associated with poor response to Neoadjuvant chemotherapy (NAC) via a potential chemoresistant effect. PMID: 27041736 By monitoring the change of fluorescence signal, the target EpCAM protein could be detected sensitively and selectively with a linear detection range from 3nM to 54nM and limit of detection (LOD) around 450pM. In addition, this nanobiosensor has been successfully used for EpCAM-expressed breast cancer MCF-7 cell detection PMID: 27614683 EpCAM, CD44 and CD133 expression could be candidate markers for Barrett esophagus disease progression PMID: 28216140 These findings are important for a better understanding of epithelial cell adhesion molecule apoptosis regulation and suggest epithelial cell adhesion molecule as a potential target for the treatment of breast cancer. PMID: 28349835 that epithelial cell adhesion molecule showed different expression pattern among salivary gland neoplasms and in different grades of mucoepidermoid carcinomas PMID: 27649957 we concluded that the peptide could be a better supplement to the EpCAM antibody for capturing Circulating tumor cells (CTCs) in microfluidic system with broader spectrum PMID: 27818051 This study presented a molecular characterization of congenital tufting enteropathy Italian patients, and identified three mutations in the EpCAM gene PMID: 26684320 EpCAM serves as a potential biomarker of prognostic significance that could be used to identify oral squamous cell carcinoma patients at high risk and to predict patient survival PMID: 26401964 Findings show that the EGF-like domain of EpCAM is cleaved off in cancer cells which have undergone epithelial-mesenchymal transition. PMID: 26775583 Based on these results, it can be concluded that EpCAM is suitable for use as an EC biomarker, therapeutic target, and effective parameter for tumor transfer and prognosis evaluation by aptamer SYL3C staining PMID: 26687301 CHD4 was abundantly expressed in EpCAM(+) hepatocellular carcinoma with expression of hepatic stem cell markers and poor prognosis in two independent cohorts. PMID: 26095183 Flow cytometry assay showed doxorubicin exposure decreased EpCAM positive cell quantities in three HCC cell lines. EpCAM siRNA knock-down attenuated cell mortality after doxorubicin exposure PMID: 26984381 EpCAM based capture detects and recovers circulating tumor cells from all subtypes of breast cancer except those low claudin expression. PMID: 26556851 Increased Expression of EPCAM mRNA is associated with Recurrence After Curative Resection of Hepatocellular Carcinoma. PMID: 25791790 We revealed a new molecular mechanism of MTA1-mediated invasion and metastasis in lung cancer through downstream target EpCAM, and interfering with EpCAM function may be a novel therapeutic strategy for treatment of MTA1-overexpressing lung carcinoma PMID: 26698569 knockdown of EpCAM can inhibition breast cancer cell growth and metastasis via inhibition of the Ras/Raf/ERK signaling pathway and MMP-9 PMID: 26356670 Results indicate that the anti-epithelial cell adhesion molecule (EpCAM) monoclonal antibodie can potentially be used for cancer-targeted therapy. PMID: 26317650

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.