Recombinant Human Ephrin Type-B Receptor 1 (EPHB1) Protein (His), Active

Name: Recombinant Human Ephrin Type-B Receptor 1 (EPHB1) Protein (His), Active
Brand: Beta LifeScience
SKU: BLC-05607P
Availability: InStock

Greater than 95% as determined by SDS-PAGE.

Collections: All products, Explore high-quality enzymes for research and supplementation, Featured enzyme molecules, High-quality recombinant proteins, Kinase

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human Ephrin Type-B Receptor 1 (EPHB1) Protein (His), Active is produced by our Mammalian cell expression system. This is a protein fragment.
Purity	Greater than 95% as determined by SDS-PAGE.
Endotoxin	Less than 1.0 EU/μg as determined by LAL method.
Activity	The ED50 as determined by its ability to binding Human EFNB2 used funtional ELISA is less than 100 ug/ml.
Uniprotkb	P54762
Target Symbol	EPHB1
Synonyms	Cek 6; EK6; ELK; Elkh; EPH receptor B1; Eph tyrosine kinase 2; EPH-like kinase 6; Ephb1; EPHB1_HUMAN; Ephrin type B receptor 1; Ephrin type-B receptor 1; EPHT2; HEK 6; HEK6; NET; Neuronally-expressed EPH-related tyrosine kinase; soluble EPHB1 variant 1; Tyrosine protein kinase receptor EPH 2; Tyrosine-protein kinase receptor EPH-2
Species	Homo sapiens (Human)
Expression System	Mammalian cell
Tag	C-6His
Complete Sequence	SRKRAYSKEAVYSDKLQHYSTGRGSPGMKIYIDPFTYEDPNEAVREFAKEIDVSFVKIEEVIGAGEFGEVYKGRLKLPGKREIYVAIKTLKAGYSEKQRRDFLSEASIMGQFDHPNIIRLEGVVTKSRPVMIITEFMENGALDSFLRQNDGQFTVIQLVGMLRGIAAGMKYLAEMNYVHRDLAARNILVNSNLVCKVSDFGLSRYLQDDTSDPTYTSSLGGKIPVRWTAPEAIAYRKFTSASDVWSYGIVMWEVMSFGERPYWDMSNQDVINAIEQDYRLPPPMDCPAALHQLMLDCWQKDRNSRPRFAEIVNTLDKMIRNPASLKTVATITAVPSQPLLDRSIPDFTAFTTVDDWLSAIKMVQYRDSFLTAGFTSLQLVTQMTSEDLLRIGITLAGHQKKILNSIHSMRVQISQSPTAMA
Expression Range	564-984aa
Protein Length	Partial
Mol. Weight	48.8 kDa
Research Area	Signal Transduction
Form	Lyophilized powder
Buffer	Lyophilized from a 0.2 μm Filtered 20 mM Tris-HCl, 150 mM NaCl, pH 8.0
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Receptor tyrosine kinase which binds promiscuously transmembrane ephrin-B family ligands residing on adjacent cells, leading to contact-dependent bidirectional signaling into neighboring cells. The signaling pathway downstream of the receptor is referred to as forward signaling while the signaling pathway downstream of the ephrin ligand is referred to as reverse signaling. Cognate/functional ephrin ligands for this receptor include EFNB1, EFNB2 and EFNB3. During nervous system development, regulates retinal axon guidance redirecting ipsilaterally ventrotemporal retinal ganglion cells axons at the optic chiasm midline. This probably requires repulsive interaction with EFNB2. In the adult nervous system together with EFNB3, regulates chemotaxis, proliferation and polarity of the hippocampus neural progenitors. In addition to its role in axon guidance plays also an important redundant role with other ephrin-B receptors in development and maturation of dendritic spines and synapse formation. May also regulate angiogenesis. More generally, may play a role in targeted cell migration and adhesion. Upon activation by EFNB1 and probably other ephrin-B ligands activates the MAPK/ERK and the JNK signaling cascades to regulate cell migration and adhesion respectively. Involved in the maintenance of the pool of satellite cells (muscle stem cells) by promoting their self-renewal and reducing their activation and differentiation.
Subcellular Location	Cell membrane; Single-pass type I membrane protein. Early endosome membrane. Cell projection, dendrite.
Protein Families	Protein kinase superfamily, Tyr protein kinase family, Ephrin receptor subfamily
Database References	HGNC: 3392 OMIM: 600600 KEGG: hsa:2047 STRING: 9606.ENSP00000381097 UniGene: PMID: 29550816 investigate NET could modulate one's attention orientation to facial expressions, we categorized individuals according to the genotypes of the -182 T/C (rs2242446) polymorphism. Our results indicated that the -182 T/C polymorphism significantly modulated attention orientation to facial expressions, of which the CC genotype facilitated attention reorientation to the locations where cued faces were previously presented. PMID: 27541794 some of the mutations found in EPHB1 may contribute to an increased invasive capacity of cancers. PMID: 28108514 Association of EPHB1 rs11918092 with symptoms of schizophrenia in Chinese Zhuang and Han populations. PMID: 27028544 The tumor-suppressor function of EphB1 is clinically relevant across many malignancies, suggesting that EphB1 is an important regulator of common cancer cell transforming pathways. PMID: 25944917 In medulloblastoma cell lines, EphB1 downregulation or knockdown reduced cell growth, viability, cell-cycle regulator expression, and migration, but increased radiosensitivity and the percentage of cells in G1 phase of the cell cycle. PMID: 25879388 Our results indicate that EphB1 may be involved in carcinogenesis of renal cell carcinoma PMID: 25120806 The genes CD248, Ephb1 and P2RY2 were detected as the top overexpressed in GC biopsies. PMID: 24716914 The study presents the first structure of the EphB1 tyrosine kinase domain determined by X-ray crystallography to 2.5A. PMID: 24677421 EphB1 and Ephrin-B could be regarded as independent good prognostic factors and important biological markers for Squamous cell/adenosquamous carcinoma and adenocarcinoma of gallbladder. PMID: 24606480 Our data indicate that loss of EphB1 protein is associated with metastasis and poorer survival in patients with serous ovarian cancer PMID: 24427352 Low EphB1 expression is associated with glioma. PMID: 24121831 EphB1 stimulation triggered approximately 50% serine-threonine PTEN dephosphorylation and PTEN-Cbl complex disruption, a process requiring PTEN protein phosphatase activity. PMID: 23118026 No association is found for EPH receptor B1 and susceptibility to schizophrenia. PMID: 21041834 EPHB1 polymorphisms may be associated with susceptibility to hepatocellular carcinoma in the Korean population. PMID: 21763378 Data show that EphB receptors interact with E-cadherin and with the metalloproteinase ADAM10 at sites of adhesion. PMID: 21804545 analysis of EphB1, EphB2, and EphB4-binding peptides interaction with antagonists with ephrin-like affinity PMID: 15722342 The ubiquitin ligase Cbl induces the ubiquitination and lysosomal degradation of activated EphB1, a process requiring EphB1 and Src kinase activity. PMID: 18034775 Transgenic EphB1 and ephrin-B3 cooperatively regulate the proliferation and migration of neural progenitors in the hippocampus. PMID: 18057206 Loss of expression of EphB1 protein in gastric carcinoma is associated with invasion and metastasis PMID: 18424888 EphB1 may have roles in the pathogenesis and development of colorectal cancer. PMID: 18931529

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.