Recombinant Human Ephrin-A1 (EFNA1) Protein (hFc), Active
Beta LifeScience
SKU/CAT #: BLC-05872P
Greater than 95% as determined by SDS-PAGE.
Recombinant Human Ephrin-A1 (EFNA1) Protein (hFc), Active
Beta LifeScience
SKU/CAT #: BLC-05872P
Collections: Enzymes, Featured enzyme molecules, Kinase, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Human Ephrin-A1 (EFNA1) Protein (hFc), Active is produced by our Mammalian cell expression system. This is a full length protein. |
Purity | Greater than 95% as determined by SDS-PAGE. |
Endotoxin | Less than 1.0 EU/μg as determined by LAL method. |
Activity | The ED50 as determined by its ability to bind Human EphA2 in functional ELISA is less than 10 ug/ml. |
Uniprotkb | P20827 |
Target Symbol | EFNA1 |
Synonyms | B61; ECKLG; EFL 1; EFL1; EFNA 1; Efna1; EFNA1_HUMAN; EPH related receptor tyrosine kinase ligand 1; EPH-related receptor tyrosine kinase ligand 1; Ephrin-A1; Ephrin-A1, secreted form ; EphrinA1; EPLG 1; EPLG1; Immediate early response protein B61; LERK 1; LERK-1; LERK1; Ligand of eph related kinase 1; OTTHUMP00000033242; OTTHUMP00000033271; secreted form; TNF alpha-induced protein 4; TNFAIP 4; TNFAIP4; Tumor necrosis factor alpha induced protein 4 ; Tumor necrosis factor alpha-induced protein 4 |
Species | Homo sapiens (Human) |
Expression System | Mammalian cell |
Tag | C-hFc |
Complete Sequence | DRHTVFWNSSNPKFRNEDYTIHVQLNDYVDIICPHYEDHSVADAAMEQYILYLVEHEEYQLCQPQSKDQVRWQCNRPSAKHGPEKLSEKFQRFTPFTLGKEFKEGHSYYYISKPIHQHEDRCLRLKVTVSGKITHSPQAHDNPQEKRLAADDPEVRVLHSIGHS |
Expression Range | 19-182aa |
Protein Length | Full Length of Mature Protein |
Mol. Weight | 46.5 kDa |
Research Area | Signal Transduction |
Form | Lyophilized powder |
Buffer | Lyophilized from a 0.2 μm filtered 1xPBS, pH 7.4 |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | Cell surface GPI-bound ligand for Eph receptors, a family of receptor tyrosine kinases which are crucial for migration, repulsion and adhesion during neuronal, vascular and epithelial development. Binds promiscuously Eph receptors residing on adjacent cells, leading to contact-dependent bidirectional signaling into neighboring cells. Plays an important role in angiogenesis and tumor neovascularization. The recruitment of VAV2, VAV3 and PI3-kinase p85 subunit by phosphorylated EPHA2 is critical for EFNA1-induced RAC1 GTPase activation and vascular endothelial cell migration and assembly. Exerts anti-oncogenic effects in tumor cells through activation and down-regulation of EPHA2. Activates EPHA2 by inducing tyrosine phosphorylation which leads to its internalization and degradation. Acts as a negative regulator in the tumorigenesis of gliomas by down-regulating EPHA2 and FAK. Can evoke collapse of embryonic neuronal growth cone and regulates dendritic spine morphogenesis. |
Subcellular Location | Cell membrane; Lipid-anchor, GPI-anchor.; [Ephrin-A1, secreted form]: Secreted. |
Protein Families | Ephrin family |
Database References | |
Tissue Specificity | Brain. Down-regulated in primary glioma tissues compared to the normal tissues. The soluble monomeric form is expressed in the glioblastoma multiforme (GBM) and breast cancer cells (at protein level). |
Gene Functions References
- ephrin-A1 seems to be remarkably involved in elementary processes of endothelial migration like cellular polarization, migratory direction and speed. PMID: 27742560
- Findings show that EFNA1 expression is a useful marker for predicting a high risk of recurrence in hepatocellular carcinoma patients but not EPHA2. PMID: 24969670
- Results suggest that EFNA1 is involved in colorectal tumorigenesis, and rs12904 A>G polymorphism in the 3' UTR of EFNA1 is associated with CRC susceptibility in a Chinese population. PMID: 24175772
- EphA2-ephrinA1 trans-endocytosis is sensitive to the mechanical properties of a cell's microenvironment PMID: 24853748
- Ephrin-A1 is upregulated in tumor microenvironment and promotes angiogenesis through a coordinated cross-talk with PI3K/Akt-dependent eNOS activation. PMID: 24040255
- The interaction between ephrin-As, Eph receptors and integrin alpha3 is plausibly important for the crosstalk between Eph and integrin signalling pathways at the membrane protrusions and in the migration of brain cancer cells. PMID: 23686814
- Increased expression of EFNA1 mRNA is associated with gastric cancer. PMID: 23065816
- Expression of EPHRIN-A1 tends to be associated with worse survival in head and neck cancer. PMID: 24330498
- EFNA1 expression is a useful marker for predicting high risk of relapse and cancer-related death in patients who have undergone curative resection for CRC. PMID: 23258614
- Findings suggest that the glycosylation on ephrin-A1 plays a critical role in the binding and activation of the EphA2 receptor. PMID: 23661698
- present study showed a high expression of EphA2/ephrinA1 in adenoid cystic carcinoma. EphA2/ephrinA1 can serve as a novel therapy target for adenoid cystic carcinoma. PMID: 23298804
- EphA2 activation by ephrin-A1 induces tumor suppressor gene cdx-2 expression which attenuates cell proliferation, tumor growth and thus may be a promising therapeutic target against NSCLC. PMID: 22824143
- in p-stage I NSCLC patients, those in the higher EphA2 expression and higher ephrin-A1 expression groups shared almost the same clinicopathological backgrounds which are generally considered to be better prognostic factors. PMID: 22236865
- The EphA2 ligand EphrinA1 induces EphA2 phosphorylation and intracellular internalization and degradation, thus inhibiting breast tumor progression. PMID: 22228563
- Multiple oncogenic signalling pathways are affected by ephrin-A1, from the promotion of a specific pathway in one cell or cancer type to the inhibition of the same pathway in another type of cell or cancer. [Review] PMID: 22040911
- Ovarian serous carcinomas and ovarian cancer cell lines overexpress EphA2 and EphrinA-1. Tumor patients with higher expression levels of both EphA2 and EphrinA-1 have a significantly poorer clinical outcome. PMID: 21500549
- The Eph-ephrinA system can promote cell attachment along with intercellular dissociation. PMID: 21349856
- This study demonstrated that the Eph-ephrin A system can promote intercellular dissociation in Ishikawa cells suggesting an important role in the initial step of embryo implantation by opening the endometrial epithelial cell barrier. PMID: 21138904
- Osteosarcoma samples were characterized using genome-wide microarrays: increased expression of the EphA2 receptor and its ligand EFNA1 was detected. PMID: 21166698
- up-regulation of EphA2 and down-regulation of Ephrina1 may correlate with poor prognosis for patients with high-grade glioma PMID: 20571968
- EphA2 and EphrinA1 are highly expressed in renal cell carcinoma, and positively correlated with histological differentiation, clinical stage and angiogenesis. PMID: 19950554
- EFNA1 may be a useful serum marker for the detection of hepatocellular carinoma development and progression. PMID: 19642143
- The interaction between EphA2 and this ligand protein is necessary for induction of maximal neovascularization by VEGF. PMID: 12496364
- This protein, an EphA ligand, stimulated protein degradation by EphA2. PMID: 12496371
- Ephrin-A1 stimulation of Jurkat T cells induces tyrosine phosphorylation of EphA3 receptors and cytoplasmic proteins, including c-cbl proto-oncogene, and causes down-regulation of endogenous EphA3 receptors from the cell surface and their degradation. PMID: 12794130
- A new ephrin-A1 isoform, ephrin-A1b, lacks a segment of 22 amino acids (residues 131-152). Exon 3 is spliced out in its transcript. It may regulate the function of its ephrin-A1a counterpart. PMID: 14692877
- This study demonstrates for the first time significantly reduced ephrin-A1 expression in T cells of asthma patients. PMID: 14707054
- found ephrin-A1 expressed exclusively in the invasive extravillous trophoblast in preeclampsia and normal placenta PMID: 15193868
- ephrin-A1 is expressed by venule endothelial cells PMID: 15585656
- EPHA2 and EFNA1 expression may influence the behavior of human gastric cancer. PMID: 15649254
- low molecular weight protein-tyrosine phosphatase acts as terminator of EphA2 signaling causing efficient negative feedback loop on biological response mediated by ephrinA1; tyrosine phosphorylation main event orchestrating repulsive response PMID: 16051609
- High expression of Ephrin A-1 is associated with urinary bladder carcinoma. PMID: 16428472
- Activation of ERK-1/2 plays an essential role in ephrin-A1-mediated cell migration, whixh is inhibited by green tea catechin epigallocatechin gallate. PMID: 17049832
- Ephrin-A1 serves as a critical negative regulator in the tumorigenesis of gliomas by down-regulating EphA2 and FAK. PMID: 17332925
- Increasing ephrin-A expression enhances T-cell interactions not only with purified integrin ligands but also endothelial cells, while EphA activation down-regulates these interactions. PMID: 17980912
- Soluble monmomeric EphrinA1 is released from tumor cells and is a functional ligand for the EphA2 receptor. PMID: 18794797
- The function of EphA2 and ephrinA1 in tumorigenesis and tumor progression is complex and seems to be dependent on cell type and microenvironment PMID: 19074825
- Increased expression of EphA2 and EphrinA-1 plays an important role in the progression human gastric adenocarcinoma. PMID: 19101799
- The crystal structures of an A-class complex between EphA2 and ephrin-A1 and of unbound EphA2, are presented. PMID: 19525919