Recombinant Human Enamelin (ENAM) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-06728P

Greater than 85% as determined by SDS-PAGE.
Recombinant Human Enamelin (ENAM) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-06728P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Human Enamelin (ENAM) Protein (His) is produced by our Baculovirus expression system. This is a protein fragment. |
Purity | Greater than 85% as determined by SDS-PAGE. |
Uniprotkb | Q9NRM1 |
Target Symbol | ENAM |
Species | Homo sapiens (Human) |
Expression System | Baculovirus |
Tag | C-6His |
Target Protein Sequence | ERQQQRPSNILHLPCFGSKLAKHHSSTTGTPSSDGRQSPFDGDSITPTENPNTLVELATEEQFKSINVDPLDADEHSPFEFLQRGTNVQDQVQDCLLLQA |
Expression Range | 1043-1142aa |
Protein Length | Partial |
Mol. Weight | 12.4 kDa |
Research Area | Others |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | Involved in the mineralization and structural organization of enamel. Involved in the extension of enamel during the secretory stage of dental enamel formation. |
Subcellular Location | Secreted, extracellular space, extracellular matrix. |
Database References | |
Associated Diseases | Amelogenesis imperfecta 1B (AI1B); Amelogenesis imperfecta 1C (AI1C) |
Tissue Specificity | Expressed in tooth particularly in odontoblast, ameloblast and cementoblast. |
Gene Functions References
- Lack of association between the ENAM polymorphism (rs12640848) and dental caries in Czech children was detected. PMID: 29185146
- The ENAM and TNF-alpha genes were likely associated with caries occurrence in Chinese children. The ENAM rs3796703 CT and TNF-alpha rs1800629 AG genotypes might be involved in caries susceptibility and protection, respectively. PMID: 28395167
- study investigated the phenotypic effect of SNP C14625T (rs7671281) on the thickness of human dental enamel, exploring the effects of positive selection on a dental gene PMID: 27357321
- Among the variants shared with modern humans, two are ancestral (common with apes) and one is the derived enamelin major variant, T648I (rs7671281), associated with a thinner enamel and specific to the Homo lineage. PMID: 28902892
- The study revealed the strong association between rs12640848 marker of ENAM gene and caries susceptibility in primary teeth in children from Poland. PMID: 26910531
- Overrepresentation of the G allele of the enamelin marker was seen in the erosion group compared to the unaffected group. PMID: 25791822
- Screening of ENAM and LAMB3 genes was performed by direct sequencing of genomic DNA from blood samples. PMID: 25769099
- findings provide useful information for the implication of ENAM gene polymorphism in autosomal-dominant/-recessive amelogenesis imperfecta. PMID: 25427323
- Whole-exome sequencing identified 2 novel heterozygous nonsense mutations in the ENAM gene (c.454G>T p.Glu152* in family 1, c.358C>T p.Gln120* in family 2) in the probands. Affected individuals were heterozygous for the mutation in each family. PMID: 25143514
- 2 exonic SNPs, both changing an amino acid in protein region encoded by exon 10 (p.I648T and p.R763Q), increased caries susceptibility 2.66-fold. findings support ENAM as gene candidate for caries susceptibility. PMID: 24487377
- Associations between TFIP11 (p=0.02), ENAM (p=0.00001), and AMELX (p=0.01) could be seen with caries independent of having MIH or genomic DNA copies of Streptococcus mutans detected by real time PCR in the Brazilian sample. PMID: 23790503
- Mutations in FAM83H and ENAM and related phenotypes were observed in Chinese families with amelogenesis imperfecta. PMID: 22414746
- hypocalcified amelogenesis imperfecta, Witkop type III, was unrelated to previously described mutations in the ENAM or MMP-20 genes PMID: 21504268
- The structure and composition of deciduous enamel affected by local hypoplastic autosomal dominant amelogenesis imperfecta resulting from an ENAM mutation PMID: 19923784
- A nonsense mutation in the enamelin gene causes local hypoplastic autosomal dominant amelogenesis imperfecta PMID: 11978766
- heterogeneous mutations are responsible for an autosomal-dominant hypoplastic form of amelogenesis imperfecta PMID: 12407086
- critical for proper dental enamel formation PMID: 14656895
- Demonstration of a ENAM mutation responsible for autosomal recessive amelogenesis imperfecta and localised enamel pitting. PMID: 14684688
- Ultrastructural enamel changes in the patient with the autosomal dominant ENAM g.13185-13186insAG mutation, were less pronounced compared to ultrastructural changes in patients with the autosomal dominant ENAM mutation 8344delG. PMID: 17125728
- A mutation was found in exon 9 where guanine was substituted by thymine in one of the alleles in position 817, generating a change of arginine to methionine in codon 179 of the protein. PMID: 17316551
- This work shows that bursts of adaptive enamelin evolution occur on primate lineages with inferred dietary changes. PMID: 18245370
- a single base difference g359A --> G located in exon 1 was identified and ruled out the possible mutation in exon 2, exon 3, exon 4, exon 5, exon 6, exon 7, exon 8, exon 9, exon 10, g2382, g6395 and g8344 of ENAM gene in the AI patient. PMID: 18466877
- A total of 463 individuals from 54 families were evaluated and mutations in the AMEL, ENAM and KLK4 genes were identified. PMID: 18714142
- Analysis revealed 2 ENAM mutations (autosomal-dominant g.14917delT and autosomal-recessive g.13185-13186insAG mutations). Single T deletion in exon 10 is a novel deletion mutation(g.14917delT, c.2991delT)predicted to result in premature termination codon. PMID: 19329462