Recombinant Human Elongin-C (ELOC) Protein (GST)
Beta LifeScience
SKU/CAT #: BLC-10067P

Greater than 90% as determined by SDS-PAGE.
Recombinant Human Elongin-C (ELOC) Protein (GST)
Beta LifeScience
SKU/CAT #: BLC-10067P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Human Elongin-C (ELOC) Protein (GST) is produced by our E.coli expression system. This is a full length protein. |
Purity | Greater than 90% as determined by SDS-PAGE. |
Uniprotkb | Q15369 |
Target Symbol | ELOC |
Synonyms | Elo C; EloC; ELOC_HUMAN; Elongin 15 kDa subunit; Elongin C; Elongin-C; ElonginC; RNA polymerase II transcription factor SIII subunit C; SIII; SIII p15; TCEB 1; tceb1; Transcription elongation factor B (SIII) polypeptide 1; Transcription elongation factor B polypeptide 1 |
Species | Homo sapiens (Human) |
Expression System | E.coli |
Tag | N-GST |
Target Protein Sequence | MDGEEKTYGGCEGPDAMYVKLISSDGHEFIVKREHALTSGTIKAMLSGPGQFAENETNEVNFREIPSHVLSKVCMYFTYKVRYTNSSTEIPEFPIAPEIALELLMAANFLDC |
Expression Range | 1-112aa |
Protein Length | Full Length |
Mol. Weight | 39.5kDa |
Research Area | Immunology |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | SIII, also known as elongin, is a general transcription elongation factor that increases the RNA polymerase II transcription elongation past template-encoded arresting sites. Subunit A is transcriptionally active and its transcription activity is strongly enhanced by binding to the dimeric complex of the SIII regulatory subunits B and C (elongin BC complex). In embryonic stem cells, the elongin BC complex is recruited by EPOP to Polycomb group (PcG) target genes in order generate genomic region that display both active and repressive chromatin properties, an important feature of pluripotent stem cells.; Core component of multiple cullin-RING-based ECS (ElonginB/C-CUL2/5-SOCS-box protein) E3 ubiquitin-protein ligase complexes, which mediate the ubiquitination of target proteins. This includes the von Hippel-Lindau ubiquitination complex CBC(VHL). By binding to BC-box motifs it seems to link target recruitment subunits, like VHL and members of the SOCS box family, to Cullin/RBX1 modules that activate E2 ubiquitination enzymes. A number of ECS complexes (containing either KLHDC2, KLHDC3, KLHDC10, APPBP2, FEM1A, FEM1B or FEM1C as substrate-recognition component) are part of the DesCEND (destruction via C-end degrons) pathway, which recognizes a C-degron located at the extreme C terminus of target proteins, leading to their ubiquitination and degradation. |
Subcellular Location | Nucleus. |
Protein Families | SKP1 family |
Database References | |
Tissue Specificity | Overexpressed in prostate cancer cell line PC-3 and breast cancer cell line SK-BR-3. |
Gene Functions References
- crystals of SOCS2 in complex with its adaptor proteins, Elongin C and Elongin B, underwent a change in crystallographic parameters when treated with dimethyl sulfoxide during soaking experiments. PMID: 26121586
- TCEB1-mutated renal cell carcinoma is a distinct entity with recurrent hotspot mutations, specific copy number alterations, pathway activation, and characteristic morphological features. PMID: 25676555
- The crystal structure of VHL bound to a Cul2 N-terminal domain, Elongin B, and Elongin C. PMID: 25661653
- Vif interaction with EloB-EloC may contribute to recruitment of CBF-beta to Vif, demonstrating that the EloB C-teminus may play a role in improving Vif function and that the over-expression of EloB results in Vif stabilization. PMID: 23988114
- AFF1 is a ubiquitous P-TEFb partner; full Tat transactivation requires the complete super elongation complexes PMID: 24367103
- ASB9 is unstable alone but forms a stable ternary complex with EloBC that binds with high affinity to the Cullin 5 N-terminal domain. PMID: 23837592
- PRAME expression in leukaemic cell lines is upregulated by IFN gamma and LPS, suggesting a possible role in immune responses. PRAME associates with Elongin BC complexes by binding Elongin C. PMID: 23460923
- TCEB1 and SELC14L1 are good candidate markers for predicting prognosis and progression of prostate cancer. PMID: 23083832
- Functional interaction of Notch4(ICD) and Elongin C provides novel insight into regulation of Notch signaling in epithelial cell biology and disease. PMID: 22001063
- Recombinant full-length Vif interacted with the Elongin BC complex in vitro with a K(d) of 1.9 muM and resulted in observable changes in deuterium uptake in both Elongin C and B. PMID: 20728451
- These findings suggest that Elongin c may be one of the target genes for amplification of 8q21 PMID: 12004003
- findings report that HIV-1 Vif interacts with cellular proteins Cul5, elongins B and C, and Rbx1 to form an Skp1-cullin-F-box (SCF)-like complex PMID: 14564014
- specific Elongin C and Skp1 sequences determine Cullin selection PMID: 15280393
- show that ASB2, by interacting with the Elongin BC complex, can assemble with Cullin5.Rbx1 to form an E3 ubiquitin ligase complex that stimulates polyubiquitination by the E2 ubiquitin-conjugating enzyme Ubc5 PMID: 15590664
- the E3 ubiquitin ligase activity of the Vif-BC-Cul5 complex is essential for Vif function against APOBEC3G PMID: 15781449
- Results describe the 1.9-A crystal structure of the ternary complex of SOCS2 with elongin C and elongin B. PMID: 16675548
- Elongin B/C recruitment regulates substrate binding by CIS PMID: 18508766
- TCEB1 promotes invasion of prostate cancer cells and is involved in development of hormone-refractory prostate cancer PMID: 18844214