Recombinant Human Elafin (PI3) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-04698P

Greater than 90% as determined by SDS-PAGE.

Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result of this product could indicate that this peptide derived from Yeast-expressed Homo sapiens (Human) PI3.

Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result of this product could indicate that this peptide derived from Yeast-expressed Homo sapiens (Human) PI3.
Recombinant Human Elafin (PI3) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-04698P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Human Elafin (PI3) Protein (His) is produced by our Yeast expression system. This is a full length protein. |
Purity | Greater than 90% as determined by SDS-PAGE. |
Uniprotkb | P19957 |
Target Symbol | PI3 |
Synonyms | Cementoin; ELAF_HUMAN; Elafin; Elafin/Skalp; Elastase Specific Inhibitor; Elastase-specific inhibitor; ES 1; ESI; Peptidase inhibitor 3; Peptidase inhibitor 3; skin derived; PI 3; PI-3; PI3; Pre elafin; Protease inhibitor 3 skin derived ; Protease inhibitor 3; skin derived (SKALP); Protease inhibitor WAP3; SKALP; Skin derived Anti leukoproteinase; Skin-derived antileukoproteinase; Trappin 2; WAP four disulfide core domain 14; WAP four disulfide core domain protein 14; WAP four-disulfide core domain protein 14; WAP3; WFDC14 |
Species | Homo sapiens (Human) |
Expression System | Yeast |
Tag | N-6His |
Target Protein Sequence | AQEPVKGPVSTKPGSCPIILIRCAMLNPPNRCLKDTDCPGIKKCCEGSCGMACFVPQ |
Expression Range | 61-117aa |
Protein Length | Full Length of Mature Protein |
Mol. Weight | 8.0kDa |
Research Area | Signal Transduction |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | Neutrophil and pancreatic elastase-specific inhibitor of skin. It may prevent elastase-mediated tissue proteolysis. Has been shown to inhibit the alpha-4-beta-2/CHRNA2-CHRNB2 nicotinic acetylcholine receptor and to produce a weak inhibition on Kv11.1/KCNH2/ERG1 and on the transient receptor potential cation channel subfamily V member 1 (TRPV1). |
Subcellular Location | Secreted. |
Database References | HGNC: 8947 OMIM: 182257 KEGG: hsa:5266 STRING: 9606.ENSP00000243924 UniGene: PMID: 29084078 |