Recombinant Human Egl Nine Homolog 2 (EGLN2) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-10263P
Greater than 90% as determined by SDS-PAGE.
Recombinant Human Egl Nine Homolog 2 (EGLN2) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-10263P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Human Egl Nine Homolog 2 (EGLN2) Protein (His) is produced by our E.coli expression system. This is a protein fragment. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Uniprotkb | Q96KS0 |
| Target Symbol | EGLN2 |
| Synonyms | DKFZp434E026; EGL nine (C.elegans) homolog 2; Egl nine homolog 2 (C. elegans); Egl nine homolog 2; EGLN 2; EGLN2; EGLN2_HUMAN; EIT 6; EIT6; Estrogen-induced tag 6; HIF P4H 1; HIF PH1; HIF prolyl hydroxylase 1; HIF-PH1; HIF-prolyl hydroxylase 1; HIFPH 1; HIFPH1; HPH 3; HPH-1; HPH-3; HPH3; Hypoxia inducible factor prolyl hydroxylase 1; Hypoxia-inducible factor prolyl hydroxylase 1; P4H1; PHD 1; PhD1; prolyl hydroxylase domain containing protein 1; Prolyl hydroxylase domain-containing protein 1 |
| Species | Homo sapiens (Human) |
| Expression System | E.coli |
| Tag | N-6His |
| Target Protein Sequence | MVACYPGNGLGYVRHVDNPHGDGRCITCIYYLNQNWDVKVHGGLLQIFPEGRPVVANIEPLFDRLLIFWSDRRNPHEVKPAYATRYAITVWYFDAKERAAAKDKYQLASGQKGVQVPVSQPPTPT |
| Expression Range | 283-407aa |
| Protein Length | Partial |
| Mol. Weight | 18.1kDa |
| Research Area | Cancer |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Prolyl hydroxylase that mediates hydroxylation of proline residues in target proteins, such as ATF4, IKBKB, CEP192 and HIF1A. Target proteins are preferentially recognized via a LXXLAP motif. Cellular oxygen sensor that catalyzes, under normoxic conditions, the post-translational formation of 4-hydroxyproline in hypoxia-inducible factor (HIF) alpha proteins. Hydroxylates a specific proline found in each of the oxygen-dependent degradation (ODD) domains (N-terminal, NODD, and C-terminal, CODD) of HIF1A. Also hydroxylates HIF2A. Has a preference for the CODD site for both HIF1A and HIF2A. Hydroxylated HIFs are then targeted for proteasomal degradation via the von Hippel-Lindau ubiquitination complex. Under hypoxic conditions, the hydroxylation reaction is attenuated allowing HIFs to escape degradation resulting in their translocation to the nucleus, heterodimerization with HIF1B, and increased expression of hypoxy-inducible genes. EGLN2 is involved in regulating hypoxia tolerance and apoptosis in cardiac and skeletal muscle. Also regulates susceptibility to normoxic oxidative neuronal death. Links oxygen sensing to cell cycle and primary cilia formation by hydroxylating the critical centrosome component CEP192 which promotes its ubiquitination and subsequent proteasomal degradation. Hydroxylates IKBKB, mediating NF-kappa-B activation in hypoxic conditions. Also mediates hydroxylation of ATF4, leading to decreased protein stability of ATF4. |
| Subcellular Location | Nucleus. |
| Database References | HGNC: 14660 OMIM: 606424 KEGG: hsa:112398 STRING: 9606.ENSP00000307080 UniGene: PMID: 29693343 |
