Recombinant Human Egf-Like Repeat And Discoidin I-Like Domain-Containing Protein 3 (EDIL3) Protein (His)

Name: Recombinant Human Egf-Like Repeat And Discoidin I-Like Domain-Containing Protein 3 (EDIL3) Protein (His)
Brand: Beta LifeScience
SKU: BLC-00991P
Price: 299.0 USD
Availability: InStock

Greater than 85% as determined by SDS-PAGE.

Price Save $765

Size

100ug

Product Overview

Description	Recombinant Human Egf-Like Repeat And Discoidin I-Like Domain-Containing Protein 3 (EDIL3) Protein (His) is produced by our Baculovirus expression system. This is a full length protein.
Purity	Greater than 85% as determined by SDS-PAGE.
Uniprotkb	O43854
Target Symbol	EDIL3
Synonyms	(Developmentally-regulated endothelial cell locus 1 protein)(Integrin-binding protein DEL1)
Species	Homo sapiens (Human)
Expression System	Baculovirus
Tag	C-6His
Target Protein Sequence	DICDPNPCENGGICLPGLADGSFSCECPDGFTDPNCSSVVEVASDEEEPTSAGPCTPNPCHNGGTCEISEAYRGDTFIGYVCKCPRGFNGIHCQHNINECEVEPCKNGGICTDLVANYSCECPGEFMGRNCQYKCSGPLGIEGGIISNQQITASSTHRALFGLQKWYPYYARLNKKGLINAWTAAENDRWPWIQINLQRKMRVTGVITQGAKRIGSPEYIKSYKIAYSNDGKTWAMYKVKGTNEDMVFRGNIDNNTPYANSFTPPIKAQYVRLYPQVCRRHCTLRMELLGCELSGCSEPLGMKSGHIQDYQITASSIFRTLNMDMFTWEPRKARLDKQGKVNAWTSGHNDQSQWLQVDLLVPTKVTGIITQGAKDFGHVQFVGSYKLAYSNDGEHWTVYQDEKQRKDKVFQGNFDNDTHRKNVIDPPIYARHIRILPWSWYGRITLRSELLGCTEEE
Expression Range	24-480aa
Protein Length	Full Length of Mature Protein
Mol. Weight	57.0 kDa
Research Area	Cardiovascular
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Promotes adhesion of endothelial cells through interaction with the alpha-v/beta-3 integrin receptor. Inhibits formation of vascular-like structures. May be involved in regulation of vascular morphogenesis of remodeling in embryonic development.
Subcellular Location	Secreted.
Database References	HGNC: 3173 OMIM: 606018 KEGG: hsa:10085 STRING: 9606.ENSP00000296591 UniGene: Hs.482730

Gene Functions References

EDIL3 may be implicated in retinal neovascularization in vitro. Silencing EDIL3 expression was demonstrated to impair the proliferative, migratory and tube forming capabilities of HRECs in vitro. PMID: 28765888
these data reveal an unrecognised function of endogenous Del-1 as a local inhibitor of ischaemia-induced angiogenesis by restraining LFA-1-dependent homing of pro-angiogenic haematopoietic cells to ischaemic tissues PMID: 28447099
Del-1-induced HSC proliferation and myeloid lineage commitment were mediated by beta3 integrin on hematopoietic progenitors. PMID: 28846069
Del-1 pre-treatment of blood before addition of islets diminished coagulation activation and islet damage PMID: 26676803
Del-1 on circulating EVs is a promising marker to improve identification of patients with early-stage breast cancer and distinguish breast cancer from benign breast tumors and noncancerous diseases. PMID: 26603257
Overexpressed EDIL3 promotes anchorage-independent tumor growth in human pancreatic cancer. PMID: 26735172
Overexpression of the Del-1 gene potentiates proliferation and invasion of lung carcinoma cells. PMID: 26545781
The importance of interaction between EDIL3 and integrin alphaV. PMID: 25273699
The reciprocal regulation between Del-1 and inflammation may contribute to optimally balance the protective and the potentially harmful effects of inflammatory cell recruitment. PMID: 24416060
Downregulation of developmentally regulated endothelial cell locus-1 inhibits the growth of colon cancer. PMID: 19292890
Del-1 may act as a gatekeeper of adrenal gland inflammation and may regulate the integrity of the hypothalamic-pituitary-adrenal axis stress response, thereby modulating adrenal (dys)function in the course of SIRS. PMID: 23364949
database search for EGF domain sequences shows that this RGD finger is likely an evolutionary insertion and unique to the EGF domain of Del-1 PMID: 22601780
Del-1 mediates phosphatidylserine- and integrin-dependent endothelial uptake of microparticles by endocytosis. PMID: 22388320
High expression level of EDIL3 predicts poor prognosis of hepatocellular carcinoma patients. PMID: 20857535
Del1 mediates vascular smooth muscle cell adhesion, migration, and proliferation through interaction with integrin alpha(v)beta(3). PMID: 11959660
acts as an angiogenic factor in the context of solid tumor formation; the increase in vascularization accelerates tumor growth through decreased apoptosis PMID: 12074641
Alpha v beta 5, alpha v beta 5 and their ligands Del-1 and L1 play an important role in the process of tumor cells moving from the original place. PMID: 18090124

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.