Recombinant Human Early Growth Response Protein 1 (EGR1) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-10863P

Greater than 90% as determined by SDS-PAGE.
Recombinant Human Early Growth Response Protein 1 (EGR1) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-10863P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Human Early Growth Response Protein 1 (EGR1) Protein (His) is produced by our Yeast expression system. This is a protein fragment. |
Purity | Greater than 90% as determined by SDS-PAGE. |
Uniprotkb | P18146 |
Target Symbol | EGR1 |
Synonyms | AT225; Early growth response 1; Early growth response protein 1; EGR 1; EGR-1; EGR1; EGR1_HUMAN; G0S30; KROX 24; KROX24; Nerve growth factor-induced clone A; Nerve growth factor-induced protein A; NGFI-A; NGFIA; TIS8; Transcription factor ETR103; Transcription factor Zif268; ZIF 268; ZIF268; Zinc finger protein 225; Zinc finger protein Krox-24; ZNF225 |
Species | Homo sapiens (Human) |
Expression System | Yeast |
Tag | N-6His |
Target Protein Sequence | SPVATSYPSPVTTSYPSPATTSYPSPVPTSFSSPGSSTYPSPVHSGFPSPSVATTYSSVPPAFPAQVSSFPSSAVTNSFSASTGLSDMTATFSPRTIEIC |
Expression Range | 444-543aa |
Protein Length | Partial |
Mol. Weight | 12.1kDa |
Research Area | Transcription |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | Transcriptional regulator. Recognizes and binds to the DNA sequence 5'-GCG(T/G)GGGCG-3'(EGR-site) in the promoter region of target genes. Binds double-stranded target DNA, irrespective of the cytosine methylation status. Regulates the transcription of numerous target genes, and thereby plays an important role in regulating the response to growth factors, DNA damage, and ischemia. Plays a role in the regulation of cell survival, proliferation and cell death. Activates expression of p53/TP53 and TGFB1, and thereby helps prevent tumor formation. Required for normal progress through mitosis and normal proliferation of hepatocytes after partial hepatectomy. Mediates responses to ischemia and hypoxia; regulates the expression of proteins such as IL1B and CXCL2 that are involved in inflammatory processes and development of tissue damage after ischemia. Regulates biosynthesis of luteinizing hormone (LHB) in the pituitary. Regulates the amplitude of the expression rhythms of clock genes: ARNTL/BMAL1, PER2 and NR1D1 in the liver via the activation of PER1 (clock repressor) transcription. Regulates the rhythmic expression of core-clock gene ARNTL/BMAL1 in the suprachiasmatic nucleus (SCN). |
Subcellular Location | Nucleus. Cytoplasm. |
Protein Families | EGR C2H2-type zinc-finger protein family |
Database References | HGNC: 3238 OMIM: 128990 KEGG: hsa:1958 STRING: 9606.ENSP00000239938 UniGene: PMID: 29399809 |