Recombinant Human E3 Ubiquitin-Protein Ligase Znrf3 (ZNRF3) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-01334P

Greater than 90% as determined by SDS-PAGE.
Recombinant Human E3 Ubiquitin-Protein Ligase Znrf3 (ZNRF3) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-01334P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Human E3 Ubiquitin-Protein Ligase Znrf3 (ZNRF3) Protein (His) is produced by our Baculovirus expression system. This is a protein fragment. |
Purity | Greater than 90% as determined by SDS-PAGE. |
Uniprotkb | Q9ULT6 |
Target Symbol | ZNRF3 |
Synonyms | RING finger protein 203 Zinc/RING finger protein 3 |
Species | Homo sapiens (Human) |
Expression System | Baculovirus |
Tag | C-6His |
Target Protein Sequence | KETAFVEVVLFESSPSGDYTTYTTGLTGRFSRAGATLSAEGEIVQMHPLGLCNNNDEEDLYEYGWVGVVKLEQPELDPKPCLTVLGKAKRAVQRGATAVIFDVSENPEAIDQLNQGSEDPLKRPVVYVKGADAIKLMNIVNKQKVARARIQHRPPRQPTEYFDM |
Expression Range | 56-219aa |
Protein Length | Partial |
Mol. Weight | 23.8 kDa |
Research Area | Epigenetics And Nuclear Signaling |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | E3 ubiquitin-protein ligase that acts as a negative regulator of the Wnt signaling pathway by mediating the ubiquitination and subsequent degradation of Wnt receptor complex components Frizzled and LRP6. Acts on both canonical and non-canonical Wnt signaling pathway. Acts as a tumor suppressor in the intestinal stem cell zone by inhibiting the Wnt signaling pathway, thereby resticting the size of the intestinal stem cell zone. Along with RSPO2 and RNF43, constitutes a master switch that governs limb specification. |
Subcellular Location | Cell membrane; Single-pass type I membrane protein. |
Protein Families | ZNRF3 family |
Database References | HGNC: 18126 OMIM: 612062 KEGG: hsa:84133 STRING: 9606.ENSP00000443824 UniGene: PMID: 30348125 |