Recombinant Human E3 Ubiquitin-Protein Ligase Mib1 (MIB1) Protein (His)

Name: Recombinant Human E3 Ubiquitin-Protein Ligase Mib1 (MIB1) Protein (His)
Brand: Beta LifeScience
SKU: BLC-08304P
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Collections: All products, High-quality recombinant proteins, Other recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human E3 Ubiquitin-Protein Ligase Mib1 (MIB1) Protein (His) is produced by our E.coli expression system. This is a protein fragment.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	Q86YT6
Target Symbol	MIB1
Synonyms	DAPK-interacting protein 1; Dip 1; DIP-1; Dip1; E3 ubiquitin protein ligase MIB 1; E3 ubiquitin protein ligase MIB1; E3 ubiquitin-protein ligase mib1; KIAA1323; LVNC7; MIB; mib1; MIB1_HUMAN; Mind bomb homolog 1; Mindbomb E3 ubiquitin protein ligase 1; Ubiquitin ligase mind bomb; Zinc finger ZZ type with ankyrin repeat domain protein 2; ZZANK2; ZZZ6
Species	Homo sapiens (Human)
Expression System	E.coli
Tag	N-6His
Target Protein Sequence	RNNRVMVEGVGARVVRGPDWKWGKQDGGEGHVGTVRSFESPEEVVVVWDNGTAANYRCSGAYDLRILDSAPTGIKHDGTMCDTCRQQPIIGIRWKCAECTNYDLCTVCYHGDKHHLRHRFYRITTPGSERVLLESRRKSKKITARGIFAGARVVRGVDWQWEDQDGGNGRRGKVTEIQDWSASSPHSAAYVLWDNGAKNLYRVGFEGMSDLKCVQDAKGGSFYRDHCPVLGEQNGNRNPGGLQIGDLVNIDLDLEIVQSLQHGHGGWTDGMFETLTTTGTVCGIDEDHDIVVQYPSGNRWTFNPAVLTKANIVRSGDAAQGAEGGTSQ
Expression Range	5-332aa
Protein Length	Partial
Mol. Weight	40.1kDa
Research Area	Signal Transduction
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	E3 ubiquitin-protein ligase that mediates ubiquitination of Delta receptors, which act as ligands of Notch proteins. Positively regulates the Delta-mediated Notch signaling by ubiquitinating the intracellular domain of Delta, leading to endocytosis of Delta receptors. Probably mediates ubiquitination and subsequent proteasomal degradation of DAPK1, thereby antagonizing anti-apoptotic effects of DAPK1 to promote TNF-induced apoptosis. Involved in ubiquitination of centriolar satellite CEP131, CEP290 and PCM1 proteins and hence inhibits primary cilium formation in proliferating cells. Mediates 'Lys-63'-linked polyubiquitination of TBK1, which probably participates in kinase activation.
Subcellular Location	Cytoplasm. Cytoplasm, cytoskeleton, microtubule organizing center, centrosome, centriolar satellite. Cell membrane.
Database References	HGNC: 21086 OMIM: 608677 KEGG: hsa:57534 STRING: 9606.ENSP00000261537 UniGene: PMID: 27212451 In the absence of PCM1, Mib1 destabilizes Talpid3 through poly-ubiquitylation and suppresses cilium assembly. PMID: 27146717 The aim of the study was to evaluate the caspase-3 and survivin expression in correlation with MIB-1 expression in gliomas of various grade. PMID: 26995334 provided evidences that miR-10 regulates human endothelial cells behaviour through targeting Mib1 as well PMID: 26825552 these results identify the interaction between Mib1 and Plk4 as a new and important element in the control of centriole homeostasis. PMID: 25795303 Expression of MIB1 ligase protein, human was correlated with tumor grade and Figo stages. PMID: 26204652 Data show how E3 ubiquitin protein ligase Mind bomb protein recognizes notch receptor ligands. PMID: 25747658 a significant survival benefit for p16-positive vaginal cancers compared with p16-negative cancers for stages I and II. No difference was observed in survival for MIB-1-positive tumors PMID: 25319982 Invasive adenomas have a higher inducible nitric oxide synthase, and this correlated with the MIB-1 PMID: 24008756 This is the first published study ever assessing the expression of COX-2, p16 and Ki67 markers in ductal carcinoma in situ breast tumors. PMID: 25077370 Data show that the E3 ubiquitin ligase, mind bomb 1 (Mib1), interacts with and ubiquitinates SMN and facilitates its degradation. PMID: 23615451 MIB-1 was found to be associated with estrogen receptors in the stromal component PMID: 23442362 implicate NOTCH signaling in left ventricular noncompaction and indicate that MIB1 mutations arrest chamber myocardium development, preventing trabecular maturation and compaction PMID: 23314057 MIB1 negatively regulates TNFalpha- and IL1beta-induced NF-kappaB target gene activation PMID: 22184009 RYK interacts both physically and functionally with the E3 ubiquitin MIB1. MIB1 is sufficient to activate Wnt/CTNNB1 signaling and this activity depends on endogenous RYK. PMID: 21875946 Data demonstrate that c-mip interacts with Dip1 and upregulates DAPK, which blocks the nuclear translocation of ERK1/2. PMID: 20018188 Neuralized-2 regulates a Notch ligand in cooperation with Mind bomb-1 PMID: 17003037 DAPK is found in two distinct immune complexes, one containing HSP90 and CHIP and a second complex containing only DIP1/Mib; strict modulation of DAPK activities by HSP90 heterocomplexes is critical for regulation of apoptosis and cellular homeostasis PMID: 17324930 Comparative genomic hybridization and immunohistochemical assessment of EGFR, PTEN, p53, and MIB-1 expression in 13 oligodendrogliomas, one oligoastrocytoma and 23 high-grade astrocytomas is reported. PMID: 17390041 The interaction between Mib1 and cFLIP decreases the association of caspase-8 with cFLIP, which activates caspase-8 and induces cell death PMID: 19710364

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.