Recombinant Human E3 Sumo-Protein Ligase Ranbp2 (RANBP2) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-10798P
Greater than 90% as determined by SDS-PAGE.
Recombinant Human E3 Sumo-Protein Ligase Ranbp2 (RANBP2) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-10798P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Human E3 Sumo-Protein Ligase Ranbp2 (RANBP2) Protein (His) is produced by our Yeast expression system. This is a protein fragment. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Uniprotkb | P49792 |
| Target Symbol | RANBP2 |
| Synonyms | 358 kDa nucleoporin; ANE1; E3 SUMO-protein ligase RanBP2; IIAE3; Nuclear pore complex protein Nup358; Nucleoporin 358; Nucleoporin Nup358; NUP358; p270; RAN binding protein 2; Ran-binding protein 2; RANBP2; RBP2_HUMAN; Transformation related protein 2; TRP 1; TRP 2; TRP1; TRP2 |
| Species | Homo sapiens (Human) |
| Expression System | Yeast |
| Tag | N-6His |
| Target Protein Sequence | PTEESSINYTFKTPEKAKEKKKPEDSPSDDDVLIVYELTPTAEQKALATKLKLPPTFFCYKNRPDYVSEEEEDDEDFETAVKKLNGKLYLDGSEKCRPLEENTADNEKECIIVWEKKPTVEEKAKADTLKLPPTFFCGVCSDTDEDNGNGEDFQSELQKVQEAQKSQTEEITSTTDSVYTGGTEVMVPSFCKSEEPDSITKS |
| Expression Range | 2601-2802aa |
| Protein Length | Partial |
| Mol. Weight | 24.8kDa |
| Research Area | Others |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | E3 SUMO-protein ligase which facilitates SUMO1 and SUMO2 conjugation by UBE2I. Involved in transport factor (Ran-GTP, karyopherin)-mediated protein import via the F-G repeat-containing domain which acts as a docking site for substrates. Binds single-stranded RNA (in vitro). May bind DNA. Component of the nuclear export pathway. Specific docking site for the nuclear export factor exportin-1. Sumoylates PML at 'Lys-490' which is essential for the proper assembly of PML-NB. Recruits BICD2 to the nuclear envelope and cytoplasmic stacks of nuclear pore complex known as annulate lamellae during G2 phase of cell cycle. Probable inactive PPIase with no peptidyl-prolyl cis-trans isomerase activity. |
| Subcellular Location | Nucleus. Nucleus membrane. Nucleus, nuclear pore complex. Nucleus envelope. |
| Protein Families | RanBP2 E3 ligase family |
| Database References | HGNC: 9848 OMIM: 601181 KEGG: hsa:5903 STRING: 9606.ENSP00000283195 UniGene: PMID: 27160050 |
