Recombinant Human Dynein Light Chain Roadblock-Type 1 (DYNLRB1) Protein (His-SUMO)
Beta LifeScience
SKU/CAT #: BLC-09796P
Greater than 90% as determined by SDS-PAGE.
Recombinant Human Dynein Light Chain Roadblock-Type 1 (DYNLRB1) Protein (His-SUMO)
Beta LifeScience
SKU/CAT #: BLC-09796P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Human Dynein Light Chain Roadblock-Type 1 (DYNLRB1) Protein (His-SUMO) is produced by our E.coli expression system. This is a protein fragment. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Uniprotkb | Q9NP97 |
| Target Symbol | DYNLRB1 |
| Synonyms | DYNLRB1; BITH; DNCL2A; DNLC2A; ROBLD1; HSPC162Dynein light chain roadblock-type 1; Bithoraxoid-like protein; BLP; Dynein light chain 2A; cytoplasmic; Dynein-associated protein Km23; Roadblock domain-containing protein 1 |
| Species | Homo sapiens (Human) |
| Expression System | E.coli |
| Tag | N-6His-SUMO |
| Target Protein Sequence | EVEETLKRLQSQKGVQGIIVVNTEGIPIKSTMDNPTTTQYASLMHSFILKARSTVRDIDPQNDLTFLRIRSKKNEIMVAPDKDYFLIVIQNPTE |
| Expression Range | 3-96aa |
| Protein Length | Partial |
| Mol. Weight | 26.7kDa |
| Research Area | Cancer |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Acts as one of several non-catalytic accessory components of the cytoplasmic dynein 1 complex that are thought to be involved in linking dynein to cargos and to adapter proteins that regulate dynein function. Cytoplasmic dynein 1 acts as a motor for the intracellular retrograde motility of vesicles and organelles along microtubules. |
| Subcellular Location | Cytoplasm, cytoskeleton. |
| Protein Families | GAMAD family |
| Database References | HGNC: 15468 OMIM: 607167 KEGG: hsa:83658 STRING: 9606.ENSP00000349679 UniGene: PMID: 23755307 |
